SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474979653|ref|YP_007690119.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979653|ref|YP_007690119.1|
Domain Number 1 Region: 884-1020
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.18e-30
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.025
Further Details:      
 
Domain Number 2 Region: 658-793
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.025
Further Details:      
 
Domain Number 3 Region: 9-63,279-535
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.7e-26
Family Pectate transeliminase 0.039
Further Details:      
 
Domain Number 4 Region: 573-663,794-889
Classification Level Classification E-value
Superfamily Fibronectin type III 9.96e-17
Family Fibronectin type III 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474979653|ref|YP_007690119.1|
Sequence length 1022
Comment hypothetical protein SHJGH_1119 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRDVKDKAGGDVHVRLESGTYRLTRTFALTAEDSGADGRTVVYEAAPGAHPVISGGRRVT
GWTPVDADQKVYKAKLSNLDTRQLYVNGELKTRARSQKNPSGFSKTSTGYTFTDKSLDDY
KRPSDLEVVSAWGWKLMRCPVASISGNAMTVQQPCWHNANLQQGQEIQNPTWLENARELL
DSPGEWYLDKGAGEVYYMPEKGEDMADADVTVPAVQDLVDLNGTRGAPVSDVAFKGITFA
YSTWLEPSSPDGHVEGQAGFRMVGDDNPDFDSTRLHWKKTPGAVNVSHGQHITFEGDTFT
HLGAVGLNLNTGTQHTTITGNVFRQIAATGIQVGGVEWGDAHPDDPRDITKDTVVDNNVV
TQAADQYNGSLGILAGYTDSTTITHNKVYDLPYSGISVGWGWGLTDQGGNSAYPDNAGVP
VSDSPTISRDTVVTHNEISDIMKSQADGGAVYTLSSNPGGTVSGNYIHGVPEYAYGAVYH
DEGSRHWKNTGNAFCDVAYQWLLMNHAEDNKAQGNFTTKPNFSVQYLSKNNEVNGNVTVG
ACDQLPASIVDDAGLEPGYRHLDPGPAVTDHQAPTAPGTPAAATDFPTVADLSWPAATDD
TGVTGYSVFQDGKLVSATGTTSVRIPHLTAGQTYTFTVTARDGAGNESEPSHSLTVTMPR
GRDLALDKPATASSDSEGNVPAKAVDGDLSTRWAQGLGLPDPSWIQVDLGASYDVTGTIT
TFEKSNGYKYRVQVSPDEVHWSTVADRTADNTTAQTDYAHSDTPVTGRFVRLTVTGSSGN
GGSIYDFQVYGTPRPPSTDHTAPATPGQPTVKALLPSLVQVSWPAAADDTGVTSYVVYQD
GKRIGVTGDTAFRVANLSPDKQYSFTVVARDAALNGSDPSPAAEVTTPPDDDLALDKTAT
ASSDSEGNVPAKAVDGDLSTRWAQGLGLPDPSWLQVDLGKATGVSAVVTTFEKSSGYQYR
LEYSTDGQSWSVLDDHTGENTVTATTYSFADEPVTARYLRLTITGSSWNGGSVYELQAYG
GF
Download sequence
Identical sequences gi|474979653|ref|YP_007690119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]