SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474980261|ref|YP_007690727.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980261|ref|YP_007690727.1|
Domain Number 1 Region: 21-577
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 9.68e-109
Family Nickel-iron hydrogenase, large subunit 0.00000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474980261|ref|YP_007690727.1|
Sequence length 599
Comment hydrogen:quinone oxidoreductase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTTTEDPTRVTGRKPAQIVDMSWDPITRIIGNLGIYTKIDFANQEVVECHSTSSLFRGYS
VFMKGKDPRDAGFITSRICGICGDNHTTCSNYAQQMAYGVKPPRMAENITNLGEAAEYMF
DHTLFQDNLVFVDFCEAMVKATNPGVLARAERTDAPRGDIHGYRTIADIMRAFNPFEGEV
YKEALKVSRVTREMFCLMEGRHVHPSTLYPGGVGTMPQPNTFTDYLARLMRVIDFVKKAV
AMNDDVFDFFYEALPGYEEVGRRRIMLGCWGAWQNPDVVDYRYENMNRWGKAMYVTPGII
VDGKLVTNNLIDINLGLRVLLGSSFYDDWVNEQPFVTHDPLGNPVDMRHPWNQTTVPVPQ
KRDFAGNYSWVMSPRWYHPETGQHLALDTGGGPLARLWSTALSALVDTPYVKATGDSVRI
SLPRGEELPETTLEWRIPQWSNTIERDRARPYFVAYAAAMALQFLEESMELLRAGETKIF
EDYEVPDEAIGCGFHEAVRGVLSHHLVIRDQKIANYHPYPPTPWNASPRDIYGTPGPYED
AVQGQPIFEENGPDDFKGVDIMRTVRSFDPCLPCGVHMYMGKGRTLSTVHSPTYGANHG
Download sequence
Identical sequences A0A0S2NTS3 A0A101QDC6 H2JR29
WP_014670577.1.21199 WP_014670577.1.28171 WP_014670577.1.57224 WP_014670577.1.88765 gi|474980261|ref|YP_007690727.1| gi|386838052|ref|YP_006243110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]