SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474981266|ref|YP_007691732.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474981266|ref|YP_007691732.1|
Domain Number 1 Region: 49-338
Classification Level Classification E-value
Superfamily ADC synthase 1.03e-91
Family ADC synthase 0.00000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474981266|ref|YP_007691732.1|
Sequence length 351
Comment anthranilate synthase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MLHHPSGLPSLARFGDRVATGLLDVTSDPAALDSTGFWAVCADYEGRLTCARFAEVREEP
VPAPVPGRWRGPRPGDWTSSLDRAAYTAAVRRIREHIAAGEVYQANLCRVLSAPVDPGAD
VDALTALLARGNPAPYAGTIRLPEHGVEIATASPELFLRRDGRTVESGPIKGTGRTEADL
LEKDYAENVMIVDLVRNDIGRVCATGSVSVPDLCAVEKHPGLVHLVSTVRGELRADAGWP
ELLAAAFPPGSVTGAPKPSALTIIEALETAPRGPYCGGIGWVDADRGAAELAVGIRTFWI
DRAEGALRFGTGAGITWGSDPEGEWRETELKASRLLAVASGVYDETEGALL
Download sequence
Identical sequences H2JKA5
WP_014671577.1.21199 WP_014671577.1.57224 gi|474981266|ref|YP_007691732.1| gi|386839057|ref|YP_006244115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]