SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474981899|ref|YP_007692365.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474981899|ref|YP_007692365.1|
Domain Number 1 Region: 62-380
Classification Level Classification E-value
Superfamily ADC synthase 4.45e-59
Family ADC synthase 0.00021
Further Details:      
 
Domain Number 2 Region: 431-616
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.54e-23
Family Class I glutamine amidotransferases (GAT) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474981899|ref|YP_007692365.1|
Sequence length 623
Comment anthranilate/para-aminobenzoate synthase component I [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDLMDLLSDPRPFALLRRRTPGRDEHLVEVLLGPVTSRDRLADLPDEGLALIPFRQIRER
GFDVRDDGTPLLVLTPQETHTLSLAEALDRLPAHDVRVEGGGFDVSDEEYAETVGRVLRE
EIGRGEGANFVIRRTYEGGIPGFGRADALALFRRLLEGERGAYWTFVVHTGDRTLVGASP
EVHVRMSGGTVVMNPISGTYRYPPEGPTPEHLLGFLADGKEIEELSMVVDEELKMMCTVG
DRGGVVVGPRLKEMAHLAHTEYELRGKSSLDVREVLRETMFAATVTGSPVQNACRVIERY
ERPGRDGVGRGYYAGALALLGRDSGGAQTLDSPILIRTADISADGRLRVPVGATLVRGSD
PAGEVAETHAKAAGVLAALGVRPSRPRAERERPRLADDPRVRAALDGRRAALAPFWLRMQ
DRAPEPAGHALVVDGEDTFTAMLAHVLRSGGLEVTVRRYDEPGLRAAVLAHEGPVVLGPG
PGDPRDGADAKMRVLRELAATVIREHRHGVLGVCLGHELIAAELGLDLVRKEVPYQGAQT
EIDLFGRPETVGFYNSFVARCDEEAARELAAHGVEVSRAANGEVHALRGPGFAGVQFHPE
SVLTLNGAAVVRELIGQLRRTTV
Download sequence
Identical sequences H2JWX0
WP_014672205.1.21199 WP_014672205.1.57224 gi|386839688|ref|YP_006244746.1| gi|474981899|ref|YP_007692365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]