SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474981948|ref|YP_007692414.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474981948|ref|YP_007692414.1|
Domain Number 1 Region: 58-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.46e-50
Family Prokaryotic proteases 0.0000462
Further Details:      
 
Domain Number 2 Region: 287-358
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family HtrA-like serine proteases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474981948|ref|YP_007692414.1|
Sequence length 359
Comment putative secreted serine protease [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDASRTRARALARAVPAAVLVCCAALAAGCTAPAAQAGRDTAAATRAAVPMAANDLQSQY
QKVIREVLPSVVQIQASRDLGSGVVYDDKGHIVTNAHVVGSEKTFQVTTANSEEPLTASL
VYSYPEQDLAVVRLDRVPDGLKPAVFGDSEKVQVGQIVLAMGSPLGLSSSVTEGIVSATG
RTVSEGDSGGGTGATIANMVQTSAAINPGNSGGALVGLQGQVIGIPTLAAADPTFGNGAA
PGIGFAIPSSMVRTVADQIVRTGKVVESGRAALDITARTVVDDRYQPSGVAVVTVRPGGA
ADRAGLRAGDIITAVGDRPVTTITSLAEALAGDKPGRRTTVTYQRDGTENTVEVTLGEQ
Download sequence
Identical sequences H2JYF1
WP_014672254.1.21199 WP_014672254.1.57224 gi|474981948|ref|YP_007692414.1| gi|386839737|ref|YP_006244795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]