SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474982336|ref|YP_007692802.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982336|ref|YP_007692802.1|
Domain Number 1 Region: 659-738,831-1040
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.49e-64
Family Tail specific protease, catalytic domain 0.000000948
Further Details:      
 
Domain Number 2 Region: 3-261
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.7e-31
Family Tricorn protease N-terminal domain 0.0000733
Further Details:      
 
Domain Number 3 Region: 329-481,526-634
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 7.72e-20
Family Tricorn protease N-terminal domain 0.0076
Further Details:      
 
Domain Number 4 Region: 740-828
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000148
Family PDZ domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474982336|ref|YP_007692802.1|
Sequence length 1052
Comment protease [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTFVAEDDVWLAPVDGGRAWRVSADNVPVTRPRISPDGRHLAWTSTRDGAPEVHVAPVDG
GPAERLTYWGNGRTEVRGWTPDGRVLALGAQGRHSFRHTWAHAVPLDGGPAETLPYGPVG
DVALGPATVLLSAPMGREAAHWKRYRGGTAGKLWIDRAAGDGEGAGEFVRLHEDLDGNIE
CPVWAGDRIAFLSDHEGTGALYSSLADGSDLRRHTPLGGFYARHAAGDGTRVVYSSAGEL
WLLDDLEGAEPRRLDVRLGGPRVDLRPYPVNASRWFGEAAPDHTARGSAVCVRGGIHWVT
HRSGPARALAATPGVRARTPRVFRAEGEEWVVWVTDAEGDDALEFAPATGTVPGAPPRRL
AAGQLGRVLELAMAPDGSRAAVAAHDGRLLMVERETGEVREVDRSDDGEVSGLAFSPDSA
WLAWSHPGPRPLSQLRVAHTTDLSVTEATPLRFQDYAPAFTLDGKHLAFLSNRAFDPVYD
EHVFDLAFVVGARPHLITLAATTPSPFGPQRHGRPFETSDKDETPDGEGTPTTRIDLEGL
ADRIVPFPVEAGRYSTLRAAKDGVLWLRHPVQGVLGASRAHPEDPDPHTELERYDLAQRR
LEHLASDADHFEVSGDGKRVLLWADGRLRVVPSDRRTGTDDDGDTSVTVDLARVRQTVDP
AAEWRQMYDETGRLMRDHFWRPDLGGTDWNGVLARYRPLLARLATHSDLVDLLWEVHGEL
GTSHAYVIPRGGSGRRARHGLLGADISRHEDGSWRIDRILPSETSDPEARSPLAAPGAAV
RPGDAIIAVAGHQVDPVTGPGPLLVGTAGHPVELTVSPAGGGEPRHTVVVPIADEEPLRY
HAWVADRRAHVHAASGGRLGYLHVPDMQAPGWAQIHRDLRVEVAREGLVVDVRENRGGHT
SQLVVEKLARRIIGWDLPRGMRPTSYPLDAPRGPVVAVANEFSGSDGDIVNAAIRALGIG
PVVGTRTWGGVIGIDSRYHLLDGTLVTQPKYAMWLEGVGWDVENHGVDPDVEVVQRPQDW
AAGRDAQLDEAIRLALEALESSPAKAPPGMPT
Download sequence
Identical sequences H2K708
gi|386840125|ref|YP_006245183.1| gi|474982336|ref|YP_007692802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]