SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474982934|ref|YP_007693400.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982934|ref|YP_007693400.1|
Domain Number 1 Region: 686-765,861-1070
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.97e-63
Family Tail specific protease, catalytic domain 0.00000291
Further Details:      
 
Domain Number 2 Region: 6-261
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.44e-29
Family Tricorn protease N-terminal domain 0.0000254
Further Details:      
 
Domain Number 3 Region: 284-543,641-666
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 1.02e-20
Family Tricorn protease domain 2 0.0028
Further Details:      
 
Domain Number 4 Region: 771-850
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000837
Family Tail specific protease PDZ domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474982934|ref|YP_007693400.1|
Sequence length 1096
Comment protease [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSYLRLPHLSGDLLCFVAEDDLWLAPLDAPGRAWRLTADRTKTGHPRFSPDGRRIAYTTW
RSLVPEIHLVDVDGGPGRQLTYWGSADTQVCGWTPDGDILAVASHGQPFSHFTWAYKVPA
DGDPGGRLPWGPVADIQCADIAGEHRTLLLTGTPPHEPASWKRYRGGATGRLWLHGRRLL
PDLDGHLACPMFVAGRIAFLSDHEGVGNLYSCAHDGTDLRRHTDHDAFYARHAAGDGERV
VYQCAGDLWLVDDFSPGGTPRKLDVRLAGPRTGRRRYQVPAAQNIDGISVDDTGRASAVV
VRGSLYWLTHRDGPARTITDTPGVRVRLPEMLGSTGQIAYVTDAEGEDAVEIVHLPRATG
DRAPRRLASGALGRVLEMACDPQGERLAVASHDGRLLLIDVPEDGAAEPEDGAPEPEEGE
AGAESTITELIRSLNGPVRDLAFSPDGSWLTWSHPGIGRSLRKIKLARIKDRLIVDVTDG
RFEDENPVFTRDGRYLAFLSWRGFDPVYDVHTGDLSFPLGCRPYLVPLSSATPSPFALNP
EGRPAAGGLDPLEDEETGEAGTVTVEAEGLANRVTPFPVIASKYSGLHPVAGGGLVWLRW
PISGALGETFVNPADVSGRPTLEYFNITKAKKSELVDHLDWFTVSGDGTRLVVVDEGDLR
AVPSTEVGDADSTVWIDVRRILHQADPPAEWRQAYDEAGRLIRAYFWEPGMCGIDWAAVL
DQYRPLVERVASPDEFADLLREVLGELGTSHAYVTAARRNEGPPHYQRWQGLLGANFVRR
DGRWVVRRILAGDSSDSKARSPLAGTGIREGAVLTHVEGRPVDPVTGPYPLLAGAGGTTV
ELTFTPSEDETGHARRVAVVPLVDERPLRYQDWVAKRREVVRELSGGKCGYLHIPDMGGS
GWAQFNRDLRMEVSRPALIVDVRGNAGGHISELVIEKLTRTILGWDLTRNAQPVSYTSNA
PRGPVVALADEATSSDGDMITAAFKLLKLGPVVGQRTWGGVVGMTGRHRLGDGTVITVPM
NAAWFDAYGWSVENHGVAPDLEILRTPLDWAEGRHAQLADAVELALELLESNPAAVPPTY
SDVPNRSRPKLPPRAT
Download sequence
Identical sequences H2JT00
WP_014673236.1.21199 WP_014673236.1.57224 gi|386840725|ref|YP_006245783.1| gi|474982934|ref|YP_007693400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]