SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474983757|ref|YP_007694223.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|474983757|ref|YP_007694223.1|
Domain Number - Region: 272-352
Classification Level Classification E-value
Superfamily Gated mechanosensitive channel 0.000392
Family Gated mechanosensitive channel 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474983757|ref|YP_007694223.1|
Sequence length 800
Comment membrane-bound proton-translocating pyrophosphatase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MAGLSTPQSDHLTPLAAAVLTDDNRIIVAVIAAVALTALVVAGILVRQVLAAGEGTDSMK
KIAEAVQEGAKAYLARQLRTLGVFAVVVFFLLMLLPADDWNQRAGRSVFFLIGAAFSAAT
GYIGMWLAVRSNVRVAAAAREATPAEGEPEKDLTTVSHTAMKIAFRTGGVVGMFTVGLGL
LGASCVVLVYAADAPKVLEGFGLGAALIAMFMRVGGGIFTKAADVGADLVGKVEQGIPED
DPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVAALILGKAAFGDSGLAFPLLVPAIG
VITAMIGIFAVAPRRADRSGMSAINRGFFISAVISLALVAIAVFVYLPSKYSALDGVTDA
AIKGKDGDPRILALVAVAIGILLAAVIQQLTGYFTETNRRPVRDIGKTSLTGPATVVLSG
ISVGLESAVYTALLIGLGVYGAFLLGGTSIMLALFAVALAGTGLLTTVGVIVAMDTFGPV
SDNAQGIAEMSGDVEGAGAQVLTNLDAVGNTTKAITKGIAIATAVLAASALFGSYRDAIT
TNVQDVGAKLTGPGSPLSLSLDISQPNNLVGLIAGAAVVFLFSGLAINAVSRSAGSVVFE
VRRQFREKPGIMDFSEKPEYGKVVDICTKDALRELATPGLLAVMAPIFIGFTLGVGALGS
YLAGAIGAGTLMAVFLANSGGAWDNAKKLVEDGNHGGKGSEAHAATVIGDTVGDPFKDTA
GPAINPLLKVMNLVSLLIAPAVIKFSYGDDKNLGVRIGVAILALLVIVVAVYISKRRGIA
VGDDDSAGRVANPPDAAVVS
Download sequence
Identical sequences H2JKL9
WP_014674044.1.21199 WP_014674044.1.57224 gi|474983757|ref|YP_007694223.1| gi|386841546|ref|YP_006246604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]