SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474983998|ref|YP_007694464.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983998|ref|YP_007694464.1|
Domain Number 1 Region: 107-260
Classification Level Classification E-value
Superfamily Nqo5-like 1.96e-48
Family Nqo5-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474983998|ref|YP_007694464.1|
Sequence length 264
Comment NADH dehydrogenase subunit C [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSDANGTQGNHGVNGSANGVNGSANGVNPEKDLSASNLPGQRGQGGEEIRVQRGMFGANN
GGDTSGYGGLVRSVRLPGPATRPYGGWFDEVADELEGALEEQGLLPGNAIEKTVVDRGEL
TFHIEREHLVRVARTLRDDPALRFELCTGVSGVHYPQDKGRELHAVYHLRSITHNRLIRL
EVSAPDSDPRLPSLVSVYPTNDWHERETYDFFGIVFEGHPALTRIMMPDDWQGHPQRKDY
PLGGIPVEYKGAQIPAPDQRRSYS
Download sequence
Identical sequences A0A101QFW3 H2JQE9
WP_014674282.1.28171 gi|386841788|ref|YP_006246846.1| gi|474983998|ref|YP_007694464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]