SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474983999|ref|YP_007694465.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983999|ref|YP_007694465.1|
Domain Number 1 Region: 54-446
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 1.14e-124
Family Nqo4-like 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474983999|ref|YP_007694465.1|
Sequence length 446
Comment NADH dehydrogenase subunit D [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSTQSASAASAASARETTEGTVYTVTGGDWDEVVQSAARADDERIVVNMGPQHPSTHGVL
RLILEIEGETVTEARCGIGYLHTGIEKNLEYRTWTQGTTFVTRMDYLTSFFNETAYCLAV
EKLLGIEDQITERAKIIRVLLMELNRLSSHLVCIATGGMELGATTIMIYGFRDREMILDI
YELVTGLRMNHAYIRPGGLAQDLPPGAVDQIREFVKKMKKNLPEYDKLATGNPIFKARMQ
DVGYLDLAGCMALGATGPILRATGLPHDLRKTQPYCDYETYDFDVPTADTCDAYGRFLIR
LEEMRQSLGIVEQCLDRLQPGPVMVADKKIAWPAQLALGPDGLGNSLDHIKKIMGTSMEA
LIHHFKLVTEGFRVPPGQAYTAVESPKGELGVHAVSDGGTRPYRVHFRDPSFTNLQAMAA
MCEGGQVADVIVAVASIDPVMGGVDR
Download sequence
Identical sequences A0A0S2P449 H2JQF0
gi|386841789|ref|YP_006246847.1| WP_014674283.1.21199 WP_014674283.1.57224 WP_014674283.1.88765 gi|474983999|ref|YP_007694465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]