SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474984035|ref|YP_007694501.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984035|ref|YP_007694501.1|
Domain Number 1 Region: 23-156
Classification Level Classification E-value
Superfamily Nqo5-like 3.92e-38
Family Nqo5-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474984035|ref|YP_007694501.1|
Sequence length 448
Comment putative NADH dehydrogenase subunit [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSTAAGWLPAPAEELFGTGATAEESYDVLTVDVPPSAWLTALETARTTLSCTYFDWLSAV
DEPGTGFRVCAHVVALHPVRRLLVRTTVPHDAPALPSAVGVYAGAAWHERETHEMFGVVF
EGHPELEHLLLPETFEGHPLRKDFVLAARVAKAWPGAKEPGESEHGGPKRRQMLPPGVPD
PNEWGPLKGQLPPAPTRPARAAAGRAAGGAAGERPVRRTRSASEGSASQAAAAGGAGEAG
AAGAAGRPRRMRSASEGSVSQAAVPGEDAASRKQAATEGDATRAAAQGPADGPAAEASVA
HEPGPTPAPARPRRARSASEGSASQRTQAAPEPVDATRPAPRSSDAPWHHARPAFAKPEP
KSEQEPEPPAEPEQPPQPQPQPTLASASGEEPAPEPEPERAPAPPQAPQPQPQQEQASAP
EPRPDAPGSDPATTPDPTTPDDPAGGPQ
Download sequence
Identical sequences H2JRR6
WP_014674318.1.21199 WP_014674318.1.57224 gi|474984035|ref|YP_007694501.1| gi|386841825|ref|YP_006246883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]