SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474984352|ref|YP_007694818.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984352|ref|YP_007694818.1|
Domain Number 1 Region: 23-213
Classification Level Classification E-value
Superfamily Peptide methionine sulfoxide reductase 2.35e-76
Family Peptide methionine sulfoxide reductase 0.000000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474984352|ref|YP_007694818.1|
Sequence length 219
Comment putative peptide methionine sulfoxide reductase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MLFGRTPRLPTPEQALKGRPALAYEVPDQHTVLGTPLLGPYPEGLEVADFGLGCFWGAER
KFWQLPAGVYTTLVGYQGGYTENPTYEEVCSGLTGHTEAVRVVYDPRQISYDRLLKTFWE
SHDPTQGFRQGNDVGTQYRSAIYTHTPEQAATAQASREAYQKVLTSSGYGTITTEILPAE
GRPFYPAEAYHQQYLDKNPAGYCGLGGTGLSCPIGVARA
Download sequence
Identical sequences A0A101QIY3 H2JX98
gi|474984352|ref|YP_007694818.1| gi|386842141|ref|YP_006247199.1| WP_014674620.1.21199 WP_014674620.1.28171 WP_014674620.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]