SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474984397|ref|YP_007694863.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984397|ref|YP_007694863.1|
Domain Number 1 Region: 279-560
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.05e-57
Family Type II chitinase 0.0014
Further Details:      
 
Domain Number 2 Region: 183-269
Classification Level Classification E-value
Superfamily Fibronectin type III 2.64e-19
Family Fibronectin type III 0.00025
Further Details:      
 
Domain Number 3 Region: 41-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000918
Family CBM4/9 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474984397|ref|YP_007694863.1|
Sequence length 572
Comment chinitase A precursor [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDRVPGIPRPRGRRLAAWSAATALALSVAGLATAGPASAADVNNVKNAGFESGLANWTCT
AGSGTTVTSPVHGGTAALKATPAGQDNAQCTQTVAVKPNSTYTLSAWVQGGYSYLGVTGT
GTTDVSTWTPDSASWKQLSTTFTTGSSTTSVTVYTHGWYGQAAYYADDLSVYGPDGGGGG
DPAPTVPAAPAGLSVTGTTSSAVSLSWSAVSGATGYNVYRNGTKVTAVTGTSATVTGLTA
ATSYSFQVTATNAAGESARSATVTGTTASGTGGGGGGSLPKHAVTGYWQNFNNGATVQKL
SDVPSSYDIIAVAFADATSTPGAVSFTLDSAGLNGYTVDQFKADIKAKQAAGKKVIISVG
GEKGSVSVNDASSAANFANSVYSLMQTYGFDGVDIDLENGLNATYMTQALRALSSKAGSS
LIITMAPQTIDMQSTSNTYFQTALNIKDILTVVNTQYYNSGSMLGCDGKVYSQGTVDFLT
ALACIQLEGGLSPSQVGLGVPASTRAAGSGYVSPTVVDNALDCLTAATNCGTFKPSKTYP
ALRGAMTWSTNWDAASGNAWSNTVGPHVHALP
Download sequence
Identical sequences H2JXE3
WP_014674665.1.21199 WP_014674665.1.57224 gi|474984397|ref|YP_007694863.1| gi|386842186|ref|YP_006247244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]