SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474984603|ref|YP_007695069.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984603|ref|YP_007695069.1|
Domain Number 1 Region: 229-340
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-19
Family ATP-dependent protease Lon (La), catalytic domain 0.0054
Further Details:      
 
Domain Number 2 Region: 133-249
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000407
Family Tail specific protease PDZ domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474984603|ref|YP_007695069.1|
Sequence length 358
Comment secreted protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MLASTLMLIALLCAGVLIPVPYAEMSPGPTVNTLGEHDGEPVLQISGHKTYPADGHLNMT
TVRVTSADYRMNLVEAVYGWLAHDSKIVPHDTLYPDGKTEEQSSQENAEEFSQSQESAKV
AALKELGVPVKSWVIVSTVVKGSPAEGRLHAGDVIKAVDGTAVKQPSDVAKLVTKHKPGQ
KAVFTVVPAKEQAAAEKANTAATRTQDVTITTATSHDTGARRAVVGISAGTDHTFPFTID
IKLADVGGPSAGLMFALGIYDKLTPGSLTGGKFVAGTGTIDDNGTVGPIGGVEMKTVGAR
DRGARYFLTPADNCAAAAKDTPGGLTLVKVKTIGDALDALKDIRSGDTAALPKCTTKG
Download sequence
Identical sequences H2K229
gi|474984603|ref|YP_007695069.1| WP_014674872.1.21199 WP_014674872.1.57224 gi|386842393|ref|YP_006247451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]