SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474985061|ref|YP_007695527.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985061|ref|YP_007695527.1|
Domain Number 1 Region: 271-595
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.66e-54
Family Type II chitinase 0.016
Further Details:      
 
Domain Number 2 Region: 172-256
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-18
Family Fibronectin type III 0.00025
Further Details:      
 
Domain Number 3 Region: 36-166
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000446
Family CBM4/9 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474985061|ref|YP_007695527.1|
Sequence length 603
Comment chitinase B [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDRARRPRSLLAALTAALLAVPGITALSSAARAADADVAVNGGFESGLTGWTCTAGTTVT
SPVHSGSSALQATPAGSDNAQCSQTVTVQPNAQYTLSGYVRGSYVYLGASGTGTTDVSTW
TQSAPDWQKLSTTFRTGAATTKVTIYTHGWYGTGAYQADDLTLVGPGGSGTTQPPAAPAG
LRTTTVTSSSVALSWSAVTGATGYAVYRDGTKVQTVTGTSATVSGLAASTAYSFQVTAVN
DAGESARSAVVTATTSAGGGGGGSSDLPAHALVGYLHASFANGAGYTRLADVPDSWDVID
LAFGEPTSVTSGDIRFNRCPVTECPNVESDADFKAAVKAKQAAGKKVLISIGGQNGQVQL
TTTAARDTFVSSVSKIIDTYGLDGLDIDFEGHSLSLNADDTDFKNPTTPVIVNLISALKT
LKARYGAKFVLTMAPETFFVQNGYQYYGTGKWGGQDPRCGAYLPVIHALRDDLTLLHVQD
YNSGPIMGLDNQYHSMGGADFHIAMTDMLLTGFPVAGDPNNVFPPLRPDQVAIGMPASTN
AGNGYVSPSEVTKTLDCLTKRTNCGSYATHGTWPALRGLMTWSVNWDRFANWEFQKNFDA
YFG
Download sequence
Identical sequences H2JZ27
gi|386842852|ref|YP_006247910.1| WP_014675324.1.21199 WP_014675324.1.57224 gi|474985061|ref|YP_007695527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]