SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474985075|ref|YP_007695541.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985075|ref|YP_007695541.1|
Domain Number 1 Region: 128-238
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-17
Family HtrA-like serine proteases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474985075|ref|YP_007695541.1|
Sequence length 433
Comment metalloprotease [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTTLMFILGIVVFAVGLLVSIAWHELGHLSTAKLFGIRVPQYMVGFGPTIWSRRKGETEY
GIKAVPLGGYIRMIGMFPPDDQGRVSARSTSPWRGMIEDARSAAFEELQPGDETRMFYTR
KPWKRVIVMFAGPFMNLVLAVALFLTVLMGFGIQKETTVVESVSPCVIAQSQHRDSCKKS
DPSSPAAQAGMKAGDKIVSFDGKPTKDWNTLSDLIRDSAGKNVAFVVDRDGRAVTLHARI
ATNQVAKKDAGGNYVDGYVKAGFLGFSPATGVVKQDFGESVTWMTDRVGDAVDSLVALPG
KIPALWDAAFGDGPREPDSPMGIVGAARVTGEIATLDIPASQQLAMFVFVLAGFNLSLFL
FNMLPLLPLDGGHIAGALWESLRRNLARVLRRPDPGPFDVAKLMPVAYVVAGIFVCFTVL
VLIADVVNPVKIS
Download sequence
Identical sequences A0A0S2P719 A0A124HMB0 H2JZ41
gi|386842866|ref|YP_006247924.1| WP_014675338.1.21199 WP_014675338.1.28171 WP_014675338.1.57224 WP_014675338.1.88765 gi|474985075|ref|YP_007695541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]