SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474985440|ref|YP_007695906.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985440|ref|YP_007695906.1|
Domain Number 1 Region: 109-183
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000409
Family HtrA-like serine proteases 0.016
Further Details:      
 
Weak hits

Sequence:  gi|474985440|ref|YP_007695906.1|
Domain Number - Region: 39-67
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0811
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474985440|ref|YP_007695906.1|
Sequence length 187
Comment hypothetical protein SHJGH_6910 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MEQTALRPKPMPGQDRRADDTPDPAHRPHAVPRRGRRLRTLLCGLCAGTALVLSGVGIGT
VGATVIGMGGLAEPRRQAPPPAPAPSARATPPPAPVPAPPGPALGVEAVDAEKAGALVVG
VHVPGPGYAAGLVRGDVVLQWGQARVDTVADLARAVGRARPGTAVLLTVRHASGGYQQLT
VTPAVVI
Download sequence
Identical sequences H2K625
WP_014675702.1.21199 WP_014675702.1.57224 gi|474985440|ref|YP_007695906.1| gi|386843232|ref|YP_006248290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]