SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474986140|ref|YP_007696606.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474986140|ref|YP_007696606.1|
Domain Number 1 Region: 587-630
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000765
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474986140|ref|YP_007696606.1|
Sequence length 678
Comment endo-beta-N-acetylglucosaminidase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MNPTRRTVLIAAGAAALTPALPVPSAQAAPRAAAATPPYASYWYPDSLPAGSPGPGITWR
SLKSWRAADDPDLAFNAASIPLAARFTPTPANTTARSGQARVQALVSFGPTSANPSQGSA
TADYYALTHWAYIDELVFWGGSAGEGLILAPNAPIVDAAHRHGVPVLGNIFLPPVAYGGQ
LQWTRDLVQKDATGHYPLAAQLVAVAAAYGFDGWFVNAETSGGNTALGTAMLGFLKELKS
LAAARGQRVTWYDAMTVNGTVSWQGALNSQNQAFFQSADDMFVDFRWSAATLAASGTQAD
RLGRSRYELWAGVDVESNGSGTSVNWDAIVPTGKPHITSIGLYRPEWTRNHLPADQRAPE
DFHAADDRFWTGRSLDPSRPDGSDPWRAPAVSVADRSTVTSVPFASVFNTGHGLRWYEEG
AVTSEAPWNHLGLQDRLPSRRWAVRTAGERPAVSFDFADAWRGGSSVLVAGELDQPAVVD
LYATRLPIGVNTVAELTFRSESGDVDVELAVATAEPSAPGATPPYTYRAVNPVNSGIRAQ
SVNGWQTVTVPLTGLAGTVHALGVRLTATAGPVRWRLGGLAVRDTVTAPAAPSGARVTAA
NGGDLRLAWTAAPGAVRHYTLHRLLPDGTRRFLGATGQLAYFVAGQRPEQGETAARFELR
AVGELYDASAAVTVTHPW
Download sequence
Identical sequences H2JUU2
gi|474986140|ref|YP_007696606.1| gi|386843930|ref|YP_006248988.1| WP_014676398.1.21199 WP_014676398.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]