SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474987289|ref|YP_007688951.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474987289|ref|YP_007688951.1|
Domain Number 1 Region: 202-316,354-490
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000122
Family Sphingomyelin phosphodiesterase-like 0.044
Further Details:      
 
Domain Number 2 Region: 42-180
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 0.0000000000916
Family Fascin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474987289|ref|YP_007688951.1|
Sequence length 497
Comment endonuclease/exonuclease/phosphatase family protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRRLVAVLAALLSLTMWIQWQWPAPASASTLSDQLAKSAGQKWALLNVGNGKYVSAPDTG
SGGDYAKLYASATSITASERFTLHTDDKGSKISLRAESNGMFVSADDNNSEKLRAQGDHI
GSWEGFTLKYQGSDTDGAYYALHSENANAFVTAELGSYPDYEVLRARSASVGSWEKFRLV
PVTDSSNHVGAVSGDYKQWGTPPAPSAPTSTSVKVMTWNLCGDQNPDCVNKYSTPDHMAA
QVIGQLNDVGSTYTPDALFFEESCEKFAKPIEAALESRTGTGWDVRFAPIYYNVSSTGGG
AAVLAQKECADATGFGDRGAYGVSVAVPDENTWYRANILNSPATALDSSKTSYPVEQRAA
LCAAITSKAVMYCGAHFSTGGTNYDDPDWTYHADQLSELTTDEQIAKDNGYRAVFGGDLN
VNPPARGWDGYQVLNPVYGTYRECAQLQDANSARDGQNTTNSSKIDYIFGAGHTACAVSA
NTWGSDHHALRSTTLLP
Download sequence
Identical sequences H2KAC3
gi|386835971|ref|YP_006250139.1| WP_014677527.1.21199 WP_014677527.1.57224 gi|474987289|ref|YP_007688951.1| gi|386835971|ref|YP_006250139.1|NC_017766 gi|474987289|ref|YP_007688951.1|NC_020894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]