SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474978965|ref|YP_007689431.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474978965|ref|YP_007689431.1|
Domain Number 1 Region: 4-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000124
Family SinR domain-like 0.035
Further Details:      
 
Domain Number 2 Region: 209-386
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000256
Family BTAD-like 0.061
Further Details:      
 
Domain Number 3 Region: 124-181,336-425
Classification Level Classification E-value
Superfamily TPR-like 0.00000016
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474978965|ref|YP_007689431.1|
Sequence length 428
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTPNEGLGAHIRRLRRAAGLSQEALARPNLSPSYISLLEAGKRLPSQEVLAQLAERLGCT
PRDLTGVIPEPDSVNLEIELSCAQLALRDGDSRAALDAFTALRAKLPAGEERKGLGFATE
LGIAQCLEQLGQLEQAVRGFESLLERCGEQGRGVLDRLGVAMLLCRCYRALGEVSRAVDV
AERALADADAAGLPPTVAQLELLSALIGVYCERGDLHRANFLAGEAMSRAKLMDDRRELG
GAYWTAGTALHRRGRSGEALELVRKAVALFAEVDDARAVARVRNAQAMVLLHADDPSPET
ARALLEQSAATLRALGGGLDVVDAETALGRAEVMLGRPEQAIRHAETALGLLGPDHPLER
ARVHLVLAAAHLLQDDHEAAQAAYGRGALLLEAAEAGRQAAFAWAELGEILEKSGESERA
VWAYRRAY
Download sequence
Identical sequences H2JPF2
gi|474978965|ref|YP_007689431.1| WP_014669223.1.21199 WP_014669223.1.57224 gi|386836690|ref|YP_006241748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]