SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474979436|ref|YP_007689902.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979436|ref|YP_007689902.1|
Domain Number 1 Region: 854-915
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 5.78e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0033
Further Details:      
 
Domain Number 2 Region: 9-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000013
Family Extended AAA-ATPase domain 0.07
Further Details:      
 
Domain Number 3 Region: 601-705
Classification Level Classification E-value
Superfamily TPR-like 0.0000215
Family Tetratricopeptide repeat (TPR) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474979436|ref|YP_007689902.1|
Sequence length 921
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRFLRARFEALLRGHGGVVHLEGPSGSGKTRLLAEARAVALQRGIRVFQASADPDDQFVP
LGPVLDGVSTGGGALFDTDRLRGLAAAPEQRFWLLQELQDGLERAALDTPLLITVDDGQW
LDDMTLLALRVLPARLADHRILWIVAARSGIQAPAVSSVLEHLKKSGARHLRLNALTDED
VAGVTEDVLGAPPDAGTLRAVRRAQGVPLLLIELLRGLRDEHAVIVENDRARITTDRLPA
SFHASVRQRIDQLGAPARDVVRTASAVGRSVTVGLLAELLERPLAALIAPVQELLDTDLL
FEEDDRLHFRHDLIREAVESGLPSSVRTALRRCAADALLKRNAPLTEVAALLVDSAEPGD
QAAVRLLRTAAQELAATSPASAVHLSRRALALTAEDDPERSALLAETVLLLWQTGQPAQA
RQLAATALPGELEPEAEARLRLGLARVSSQYSFAEAAEQAGVGAALAGIPDTLRAELLAL
RCLNLSMMGDLDATATVVAETLKVAARAHNRTAWATATAVESVVRFYELDWDSAFARANQ
AAAVAADVGINHSLWVPEALWKAFLLNAAGRSPEALAESQAGIREAQRQGQAAATYLWTT
IHARALLDAGRLEDAQVEAEAAATMFDDLSTGNFADTTLLYALGRAAVYRNDLEAARRYA
KEAERMLDDSAILVRNSGSWLIALVADAEGRPHEAMRVLDEAVGTFDEAGPSLATPDDPA
DLPVFVRMALRAGAVERAAAAVRIAVHRAAVGSRFPILPAAAAHARGLFDNDLSLLLRAV
DLYQDIPRLLPRASALEDAGRKLLPIRTVDAVPYLDRALDLYTEAGAEREAARVRRRLRA
AGAPRRRTTSRGTVKGWPELTVSEVTVIRLVAQGLTNRQVAQRLDNSPHTVNTHLRHAFT
KLGTTSRAELTELVRAREHAE
Download sequence
Identical sequences H2JXY8
gi|386837160|ref|YP_006242218.1| gi|474979436|ref|YP_007689902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]