SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474981066|ref|YP_007691532.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474981066|ref|YP_007691532.1|
Domain Number 1 Region: 790-858
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.42e-19
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0031
Further Details:      
 
Domain Number 2 Region: 21-155
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000635
Family ABC transporter ATPase domain-like 0.064
Further Details:      
 
Domain Number 3 Region: 569-697
Classification Level Classification E-value
Superfamily TPR-like 0.00000911
Family Tetratricopeptide repeat (TPR) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474981066|ref|YP_007691532.1|
Sequence length 858
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTFLRRDRLAGHLDEALLTPLTVVHGAAGAGKTLLAADWAATRDEPVAWLTAQVADKGGG
TFWAYLLEALRLAGVTTSADAGLPAEAGRADDRLLTRLAAELSTRNTPVILVVDEYDRVT
DPEIADQLEFVLRQAGHGMRLVLVTRTEPLLPLHRYRAAGTITEIRNAELAFTPGEAAAL
LALHGLRLPADDVGALVERTRGWAAGLRLCALAAQGETDPRTFLKEFEADRTTIADFLLA
EVLKRQTAGTQDLLLRVSVLERFCPDLANALTGRTDAERVLTALHGQNAFVEYLGHAWFR
LHPLFGEILRAHLRVRSPELEAELHRRAARWLRRSGSLGEALGHAAAAEDWETAARAVIG
DLALGEVFTGLHCDDLSRLFSRMGPEPASAATDLVRAACELSRCEVARGSSRLRRAAQAL
AAQAGPADGDPADLAATRLSCAFLETLVARLTGAPAQAERAAQFAEQVRRDVPDALLEAH
PELIALLLTHLGSARLWAGRVRDARAALTTVVDSSGTGATEQARRECLGHLALIDYLRGW
PGRAERTALATVTAADRGGPPPAPGPGLASLVLAAVAVERDELDRAQALLDAAVDARHPP
PDPVTQAGRAIVTGRILLARGDPQAALEAADRAVVADVVSPWAEAHTASVAAAAHLAEGR
PEMAVKLLHDAPGDEPVCLVGAAQAELAAGRFEAAAELLDRMRPQGDLGPAITVRAALVR
ARLAGEDGDHAAQRGLVSRALREARRERLRRPFAEAGPWLRTLPLGALAEGRLPCGPTRR
GSPARTGEQPAPPVVEELSGRERDVLRRLAQMMSTEEIAADLYVSVNTVKTHLKSAYRKL
AVNRRHDAVRRARELGLL
Download sequence
Identical sequences H2K6T9
WP_014671382.1.21199 WP_014671382.1.57224 gi|474981066|ref|YP_007691532.1| gi|386838857|ref|YP_006243915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]