SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474982607|ref|YP_007693073.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982607|ref|YP_007693073.1|
Domain Number 1 Region: 253-335,384-466
Classification Level Classification E-value
Superfamily TPR-like 0.0000000266
Family Tetratricopeptide repeat (TPR) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474982607|ref|YP_007693073.1|
Sequence length 497
Comment hypothetical protein SHJGH_4074 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTSSQPERPPRPNLAFRQLRGRRSPAEFAALVRRAAREIGERVSCDARYIGRVEAGEIRC
PNYAYERVFLHLFPGRTLTDLGFAPRSSVRGRAARTAVETAPAEGAPGESRGASEPYESR
ETGGSRDTRGPRRRGPLEPHQVYEAHEPFAKDPLNHEESDVLRRAFMTGGGATMAAATLA
PLGLTTGATAAERPLRRAGTFEAAALEEAVRRIRLLDDRHGADGLYRRAAAPLRAAYELL
DAGATRQTTADRLHAGAGELAISVGWLAHDSGRFDDARSHYAEALATARMTGDPALEAHA
FCNTAFLARDAGRPREAVRAAQAAQRAAQPLGSDRLMSLLALREAGGWAGLADRTGCAQA
LARAHALFERGRSDADPEWMSFYGEAELEGLEAQCWSTLGDWRRASRHARRAARLQDPHF
TRNIALYTAELADDLAREGRPDEAAEAGLRVLALLDQVQSSRIQTMLAGTARVLLPHRRA
SGVSEFLDRHASVPRRV
Download sequence
Identical sequences H2JLY5
gi|386840397|ref|YP_006245455.1| gi|474982607|ref|YP_007693073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]