SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474983041|ref|YP_007693506.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983041|ref|YP_007693506.1|
Domain Number 1 Region: 183-402
Classification Level Classification E-value
Superfamily TPR-like 0.000000873
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474983041|ref|YP_007693506.1|
Sequence length 427
Comment transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MCGAEHGLDLRYDKTSVARWLRGQQPRGRAPAIIAEALGRKLGRTVTIDEIGMANGKNLA
SGVGLQFSPTVLGAIEQVCELWRSDVGRRDFLSGSSVAASALVEPSRDWLISAPDPQVAR
QAGPRVGQSDVAAVRSMTRALVDLDHQYGSGHVRPVVVHYLNSVVSGLLAGSYREAVGRE
LFAAVARLTELAGYMAVDTGQPGLAQRYYIQSLRLAQAAGDRGYGGYVLAASMSHLAAQL
GNPREIAQLARAAQEGARGQVTPRVEAMFHAAEARGHALLGDARAAQAAAGQAVTAMERA
DGSAGDDPVWIAHFDEAYLADELAHCHRDLGQADQAARYAEQSLAGHPESRARRRAIGYV
LLATAQVQQREIEQACITGMKAVELLETLRSNRGAEYLDDLQQRLEPFREEAVVREFGAR
LDLQQAA
Download sequence
Identical sequences H2JUF7
gi|386840830|ref|YP_006245888.1| gi|474983041|ref|YP_007693506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]