SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474984969|ref|YP_007695435.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984969|ref|YP_007695435.1|
Domain Number 1 Region: 91-254
Classification Level Classification E-value
Superfamily TPR-like 3.8e-33
Family BTAD-like 0.00047
Further Details:      
 
Domain Number 2 Region: 245-517
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-21
Family Extended AAA-ATPase domain 0.07
Further Details:      
 
Domain Number 3 Region: 788-973
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000193
Family Transcription factor MalT domain III 0.096
Further Details:      
 
Domain Number 4 Region: 2-77
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000249
Family PhoB-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474984969|ref|YP_007695435.1|
Sequence length 1054
Comment putative transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRFGILGPVEIRTDDGTPLDPGGPRPRALLTLLLLDAGRAVSVERLLDGLYGAEPPAGAL
GALQSQISRLRRRLAPHAGVDAGPAGYALAVAPDTVDVHRFARLAAEGRTALTAGDHQRA
AVLLRDALALWRGPALPDLPDAHADRARLEELRLAVVQDRTDAELGLGGGPELVPELRAL
LRERPLDERLYGQLMRALHAAGRSAEALAVFEEARRSLADELGADPSPALSALHLHLLRD
GSRTPARPRLPAQLTRFVGREPELARIDRALTDSRLVTLTGPGGVGKTRLALEAARVRAD
GNATRSATGADSRPADVRDVCLVELAPLTDGARIPYAVLAALGVRDGFRSPATDALDRLL
AALADREVLLVLDNCEHLVESAARTTALLLGACPQVRVLATGRESLGITGEVLVPVPPLP
EEPAVRLLLDRARAVRPDFDGHARVAEICRALDGLPLAIELAAARLRTLSVDELADRLHD
RFRVLARGDRAKAPRHRTLRAVVEWSWELLDAAERDLASRLTVFAGGATLDAVAAVCGVP
YPEDALASLVEKSFLEVSDGRYRMLETIRAFAAESLRGPGEPDATPARPRQPDATPARPR
RPSTTPGEPSADARRLRAAHAAYFLRLAEHAEPLLRGGGQLPWLGRLAAEQGNLDAALRY
LTEAAPRDALRLTAALTWFRRLRGLHGDRVPGARTLLAAVGEEPPPGLAEEYALCVMNAV
SGRGDDPADPGLIARAATLMASLDGPLRLPFTVILWSLTGGPQLSVDERVRVQLDREPWG
LALLDLGLAYQALFAGRAADAEAGFTRAWKGFQETGDRWGMANCLDPLGTFAYGRGAYGR
ALALLDEGLVHVRELDAPEETADLLRTRAVVLLAQGAPEEAVAHFTRSGDLARTAGASDK
VAGALRGLGDAARRGGDTARARVHYENALEACAATWFSVGETARILIGLGRTAAAEGNTE
SARDWLAQARAQALESSDRLLLADVADALAAVAPRPERAAELLGAAAGLRGAPLPGDPEV
ARTTEHTRACLPPEVYARAYERGRHLRSAAVSER
Download sequence
Identical sequences H2JW24
gi|474984969|ref|YP_007695435.1| WP_014675236.1.21199 WP_014675236.1.57224 gi|386842760|ref|YP_006247818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]