SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474984972|ref|YP_007695438.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984972|ref|YP_007695438.1|
Domain Number 1 Region: 587-738
Classification Level Classification E-value
Superfamily TPR-like 0.0000000556
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 
Domain Number 2 Region: 710-821
Classification Level Classification E-value
Superfamily TPR-like 0.00000262
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474984972|ref|YP_007695438.1|
Sequence length 1009
Comment hypothetical protein SHJGH_6441 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSEITDFDALRRALAENSEQPEGPARNARAEQLLAEAERLDIPLAVIEALGHQLKVYNYS
SEKDKMFVPFARLLRMWDERPEDFDAYETHSLYWVFKWMSAGMLDQPHIPLASVEKWLGE
MEHRYRLAGYSERAVRSAEFSVAAHIGDVARAERAYAAWLAADRDRMADCHACELRGQGA
WQARCGRDAEALRLWRPVLEGEFACAHEPHNVLASSLAPLLRLGRVEEARAHHLRGFRLV
RSMESMRGAYADHVEFCALTGNEARGLELLAERPAYFTDTGHPRSRLDFLAVVTLLMDRL
TELGHGGQRVPGPAGRTWTARELAAHARAEATELAERFDRRNGTSAVGDRVRARIAQRPL
VDRLPLGVRTVRPAPAVAPSPPAAPAEPDLPALLAEARRLSDTLRPQALDAWAAVARAAP
DGAGLTARDRAEIADHEAMARGPEGLELFERAAALYAEASDPGEALAARARGAYIRALTG
ELDTALTTVASLYDEALALYADEGTAVRQTASVAMSRARVLVRRVHETAGGGTGDGRGQE
FEEFTGAGSGEAAADTGQAVAEAEAAVREVLALVDGHGGGDVRLAARGAEAWAMLGELAG
VTGDAGRAAELFRRAAAAYVAAGLPWFALEYQVQVAALAHQTGDLAGAEAALRAALEHGA
PYVEPVGRAQLHLQLAEVLGGRDASGDAAEHALEAAHWADEAGESGTLGAWARHQLGGYL
LRRGRYAEAAEVLESALADLCADTHGDGTVVQARWWLGDCLGELGEHRAAAEQRLKAADL
ARHWPEQQDHATLAHLAAESLGSAGLTAEADRAYARAGELWRALGNTPFLVRSLRARAWL
ALDGEPGAADAHALMTQAVRECEAALAVAQEADREELATELGGTYRQFAELLARSVSEEA
EEAEESEEAEDPAVRAAFEAALEQMTRAVAVFATLGAAGLHLRTGAELAAGRLEADLGRP
ARAAARARGVLAAYEGAGETDETVLALREEAAYLLEAAQEQAKEDAERG
Download sequence
Identical sequences H2JW27
gi|474984972|ref|YP_007695438.1| WP_014675238.1.21199 WP_014675238.1.57224 gi|386842763|ref|YP_006247821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]