SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37528459|ref|NP_931804.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37528459|ref|NP_931804.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.19e-39
Family Frataxin-like 0.00000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37528459|ref|NP_931804.1|
Sequence length 106
Comment frataxin-like protein [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MNDSEFHQLADQLILYIEGQLDNYDGNADIDCETNGGVMTLSFDNDSKIIINRQEPFHQI
WLATKGGGYHFDYKEGQWICDRSGDNFLTMLAYAITEQSGEQFSFP
Download sequence
Identical sequences Q7MYN3
gi|37528459|ref|NP_931804.1| WP_011148713.1.100813 WP_011148713.1.49830 243265.plu4642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]