SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37524412|ref|NP_927756.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37524412|ref|NP_927756.1|
Domain Number 1 Region: 7-251
Classification Level Classification E-value
Superfamily SIS domain 1.76e-74
Family mono-SIS domain 0.000000117
Further Details:      
 
Weak hits

Sequence:  gi|37524412|ref|NP_927756.1|
Domain Number - Region: 244-281
Classification Level Classification E-value
Superfamily UBA-like 0.0505
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37524412|ref|NP_927756.1|
Sequence length 301
Comment N-acetylmuramic acid-6-phosphate etherase [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MKINLNNMVTESRNPASANIDTLPTLEMLKLINDEDKKVALAVEQTLPKIAETVDKIAEA
FRQGGRLIYIGAGTSGRLGILDASECPPTYGTKPEQVVGLIAGGHQAILHAVENAEDNQQ
LGANDLQALHFNSKDVLVGIAASGRTPYVLGAMTYAKSVGATVACISCNPESPMTQAADI
AIAPIVGPEIVTGSSRMKAGTAQKLILNMLTTGAMIRTGKVYSNLMVDVEATNAKLVERQ
KNIVIAATECNREQAEQALAECDGHCKTAIVMILAGINAQQAKTLLKKHHGFIRPTISAV
R
Download sequence
Identical sequences Q7N9D8
WP_011144789.1.100813 gi|37524412|ref|NP_927756.1| 243265.plu0403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]