SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37524833|ref|NP_928177.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37524833|ref|NP_928177.1|
Domain Number 1 Region: 20-373
Classification Level Classification E-value
Superfamily SIS domain 4.25e-56
Family double-SIS domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37524833|ref|NP_928177.1|
Sequence length 407
Comment tagatose-6-phosphate ketose/aldose isomerase [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MNELFSYTEAWLREHHALHTAREIHQQPELWRQLYQNLQREEALWRPFLQPLLSDPELQL
QIVLCGAGSSAFIGRTLAPWLREQCGLNVVAYSTTDIVPSPLQYLDPTRSTLLISYGRSG
NSPESVAAVKLADQLLPRCYHLMLTCNPGGALARYAEGRSHVCSLNMPQGSHDQSFAMTS
SFSCMTLATVLLLGPLTLEQCDEPLMAMIALCEREREQWQTQIKRLACSGFNRMMCLGSS
CFTGIAEEGALKMLELTAGHVTTRYDSSMGVRHGPKFMIERDTLVVMMLSADQYRRRYDL
DLWHELNHDGLACQIVALSGTQGKGFTVINSEQDDIWLLFPYLIFLQMLAFETSLALGIT
PDNPCPTGEVNRVVKGVEIYPYHPPYSPRIKCSRSDYVDTEYFNDPN
Download sequence
Identical sequences Q7N8A1
WP_011145206.1.100813 WP_011145206.1.49830 gi|37524833|ref|NP_928177.1| 243265.plu0834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]