SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37525161|ref|NP_928505.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37525161|ref|NP_928505.1|
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily SIS domain 4.65e-50
Family mono-SIS domain 0.0000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37525161|ref|NP_928505.1|
Sequence length 193
Comment phosphoheptose isomerase [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MYQDLIRSELNEAADTLAKFLSDDANIEAIQKAAVLLADSFKVGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYEFVFSRYIEAVGKEGDVLLGIST
SGNSGNIIKAVEAARLKGMKVITLTGKDGGKMAGTADVEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVKA
Download sequence
Identical sequences Q7N7F7
243265.plu1193 WP_011145520.1.100813 WP_011145520.1.49830 gi|37525161|ref|NP_928505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]