SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37525741|ref|NP_929085.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37525741|ref|NP_929085.1|
Domain Number 1 Region: 107-274
Classification Level Classification E-value
Superfamily SIS domain 1.03e-28
Family mono-SIS domain 0.017
Further Details:      
 
Domain Number 2 Region: 9-85
Classification Level Classification E-value
Superfamily Homeodomain-like 1.34e-17
Family RpiR-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37525741|ref|NP_929085.1|
Sequence length 277
Comment hypothetical protein plu1807 [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MSVASNLNEFQEQVRSRYSGLSKRLQQVARYVLDNTNSVAFDTVAVIAREADVPPSTLIR
FANAFDFSGFNEMKQLFRMHMVEETASYADRARLFRELDGEQEPPEDPQHILQEFARSNV
QAMQQLAARTAPEDLRNAVDLLAQAKNIYIIGLRRSFSVAAYLSYALNHLECRPLLVDGL
GGMFREQINLIGEEDVVVSISFTPYAEETLMVSERAAKAGAKQIVITDSQISPLASFSDV
CFVVKEAQVEAFRSQSATLCLVQSLAVSLAYRQGNTI
Download sequence
Identical sequences Q7N5X2
WP_011146084.1.100813 WP_011146084.1.49830 243265.plu1807 gi|37525741|ref|NP_929085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]