SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37527859|ref|NP_931204.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37527859|ref|NP_931204.1|
Domain Number 1 Region: 2-191
Classification Level Classification E-value
Superfamily SIS domain 1.88e-50
Family mono-SIS domain 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37527859|ref|NP_931204.1|
Sequence length 196
Comment DnaA initiator-associating protein DiaA [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MLDRIKVCFTESIQTQIAAAEALPDAISRAAIMMVQSLLNGNKILCCGNGGSAATAQRFA
ANMINRFETERPSLPALSLNADNVVITAISSNKQHDEIYAKQVRALGQPGDVLLAISTHG
NSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGPQDVEIRIPSHRSTRIQEVHMLTVN
CLCDLIDNTLFPHQDD
Download sequence
Identical sequences Q7N089
WP_011148136.1.100813 WP_011148136.1.49830 gi|37527859|ref|NP_931204.1| 243265.plu4004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]