SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37528636|ref|NP_931981.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37528636|ref|NP_931981.1|
Domain Number 1 Region: 4-191
Classification Level Classification E-value
Superfamily SIS domain 6.67e-51
Family mono-SIS domain 0.0000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37528636|ref|NP_931981.1|
Sequence length 196
Comment WblX protein [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MDNLDYINTYLLNSIKVKQKLADDIVTLKAISDVANLIVDAYTKNNKVLLAGNGGSAADS
QHIAAEFVSRFFYDRPGLPAIAMTTDSSMLTAIGNDYGFDKLFARQLQAQSRLGDIFIGI
STSGNSLNIIKAIEVAKEEGVTSVVLCGSGGKLKDLADIAICVPDSVTPYIQECHICIGH
MICAIVEAKIFPKEKL
Download sequence
Identical sequences Q7MY65
WP_011148886.1.100813 gi|37528636|ref|NP_931981.1| 243265.plu4823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]