SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1dw9_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dw9_B
Domain Number 1 Region: 88-156
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 4.03e-56
Family Cyanase C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.22e-20
Family Cyanase N-terminal domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1dw9_B
Sequence length 156
Comment mol:protein length:156 CYANATE LYASE
Sequence
MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARL
VGAKLDLDEDSILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVYGTTLKALVHEKFGDGI
ISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF
Download sequence
Identical sequences A0A037YNM7 A0A069XEF0 A0A070SMT6 A0A070UG43 A0A077ZI58 A0A0E1LVQ7 A0A0M7MTM3 A0A125X7T7 A0A140NAG6 A0A142GZP4 A0A1X3IRV5 A0A1X3JLV5 A0A236GET2 A0A236IBZ8 B1XBI8 E3PER7 F4SIV5 G0FBM7 H4UF20 I2XGN2 P00816 S1FI49 T9DJP0 U9ZUJ2
316385.ECDH10B_1353 316407.cynS 413997.ECB_00294 469008.ECBD_3317 511145.b0340 gi|386703564|ref|YP_006167411.1| gi|254160413|ref|YP_003043521.1| gi|251783854|ref|YP_002998158.1| gi|387620101|ref|YP_006127728.1| 1dwkA gi|388476448|ref|YP_488634.1| gi|253774671|ref|YP_003037502.1| gi|387620101|ref|YP_006127728.1| 1dw9_A 1dw9_B 1dw9_C 1dw9_D 1dw9_E 1dw9_F 1dw9_G 1dw9_H 1dw9_I 1dw9_J 1dwk_A 1dwk_B 1dwk_C 1dwk_D 1dwk_E 1dwk_F 1dwk_G 1dwk_H 1dwk_I 1dwk_J gi|251783854|ref|YP_002998158.1| APC127 gi|387610869|ref|YP_006113985.1| gi|16128325|ref|NP_414874.1| gi|170080916|ref|YP_001730236.1| NP_414874.1.90541 WP_000616243.1.100085 WP_000616243.1.100111 WP_000616243.1.100251 WP_000616243.1.10034 WP_000616243.1.100441 WP_000616243.1.100487 WP_000616243.1.10051 WP_000616243.1.100753 WP_000616243.1.100824 WP_000616243.1.100868 WP_000616243.1.10094 WP_000616243.1.100966 WP_000616243.1.101033 WP_000616243.1.101158 WP_000616243.1.101186 WP_000616243.1.101282 WP_000616243.1.101423 WP_000616243.1.101654 WP_000616243.1.101737 WP_000616243.1.101747 WP_000616243.1.10188 WP_000616243.1.10235 WP_000616243.1.10252 WP_000616243.1.10304 WP_000616243.1.1040 WP_000616243.1.10417 WP_000616243.1.10491 WP_000616243.1.10496 WP_000616243.1.1058 WP_000616243.1.1071 WP_000616243.1.10833 WP_000616243.1.11047 WP_000616243.1.11118 WP_000616243.1.1113 WP_000616243.1.11241 WP_000616243.1.11408 WP_000616243.1.11418 WP_000616243.1.1168 WP_000616243.1.11844 WP_000616243.1.11955 WP_000616243.1.11982 WP_000616243.1.12060 WP_000616243.1.12415 WP_000616243.1.12458 WP_000616243.1.12468 WP_000616243.1.12542 WP_000616243.1.12558 WP_000616243.1.12582 WP_000616243.1.12594 WP_000616243.1.12675 WP_000616243.1.12680 WP_000616243.1.127 WP_000616243.1.12756 WP_000616243.1.12775 WP_000616243.1.12914 WP_000616243.1.13002 WP_000616243.1.13031 WP_000616243.1.1312 WP_000616243.1.13136 WP_000616243.1.13176 WP_000616243.1.13239 WP_000616243.1.13258 WP_000616243.1.13281 WP_000616243.1.13333 WP_000616243.1.1345 WP_000616243.1.13585 WP_000616243.1.13608 WP_000616243.1.13618 WP_000616243.1.13664 WP_000616243.1.13877 WP_000616243.1.13949 WP_000616243.1.14030 WP_000616243.1.14346 WP_000616243.1.1438 WP_000616243.1.14468 WP_000616243.1.1461 WP_000616243.1.14811 WP_000616243.1.14833 WP_000616243.1.14871 WP_000616243.1.14992 WP_000616243.1.1512 WP_000616243.1.15121 WP_000616243.1.15177 WP_000616243.1.15259 WP_000616243.1.153 WP_000616243.1.15496 WP_000616243.1.15576 WP_000616243.1.15645 WP_000616243.1.15740 WP_000616243.1.15747 WP_000616243.1.1588 WP_000616243.1.16086 WP_000616243.1.1609 WP_000616243.1.16102 WP_000616243.1.16111 WP_000616243.1.16179 WP_000616243.1.16294 WP_000616243.1.1634 WP_000616243.1.16500 WP_000616243.1.16532 WP_000616243.1.1655 WP_000616243.1.16577 WP_000616243.1.16612 WP_000616243.1.16715 WP_000616243.1.16721 WP_000616243.1.16752 WP_000616243.1.17018 WP_000616243.1.17084 WP_000616243.1.17087 WP_000616243.1.17114 WP_000616243.1.17119 WP_000616243.1.17150 WP_000616243.1.17282 WP_000616243.1.17290 WP_000616243.1.17360 WP_000616243.1.17432 WP_000616243.1.17534 WP_000616243.1.1755 WP_000616243.1.1763 WP_000616243.1.17831 WP_000616243.1.18050 WP_000616243.1.18133 WP_000616243.1.18134 WP_000616243.1.18329 WP_000616243.1.18381 WP_000616243.1.18402 WP_000616243.1.18550 WP_000616243.1.18588 WP_000616243.1.18726 WP_000616243.1.18858 WP_000616243.1.18876 WP_000616243.1.19075 WP_000616243.1.19100 WP_000616243.1.19150 WP_000616243.1.19205 WP_000616243.1.19206 WP_000616243.1.19277 WP_000616243.1.193 WP_000616243.1.19313 WP_000616243.1.19361 WP_000616243.1.1963 WP_000616243.1.19795 WP_000616243.1.1982 WP_000616243.1.19889 WP_000616243.1.19957 WP_000616243.1.19994 WP_000616243.1.20151 WP_000616243.1.20164 WP_000616243.1.20170 WP_000616243.1.20318 WP_000616243.1.20331 WP_000616243.1.20445 WP_000616243.1.20506 WP_000616243.1.20536 WP_000616243.1.2063 WP_000616243.1.20638 WP_000616243.1.20691 WP_000616243.1.20724 WP_000616243.1.20730 WP_000616243.1.20737 WP_000616243.1.20943 WP_000616243.1.20982 WP_000616243.1.2100 WP_000616243.1.21020 WP_000616243.1.21033 WP_000616243.1.21122 WP_000616243.1.21251 WP_000616243.1.2142 WP_000616243.1.21470 WP_000616243.1.2156 WP_000616243.1.21573 WP_000616243.1.21661 WP_000616243.1.21733 WP_000616243.1.21758 WP_000616243.1.21771 WP_000616243.1.21823 WP_000616243.1.21915 WP_000616243.1.22060 WP_000616243.1.22314 WP_000616243.1.22359 WP_000616243.1.22363 WP_000616243.1.22450 WP_000616243.1.22574 WP_000616243.1.22579 WP_000616243.1.22632 WP_000616243.1.22649 WP_000616243.1.22669 WP_000616243.1.22690 WP_000616243.1.22783 WP_000616243.1.22830 WP_000616243.1.22885 WP_000616243.1.23044 WP_000616243.1.23090 WP_000616243.1.23511 WP_000616243.1.23549 WP_000616243.1.2362 WP_000616243.1.23676 WP_000616243.1.23812 WP_000616243.1.23898 WP_000616243.1.23945 WP_000616243.1.24045 WP_000616243.1.2418 WP_000616243.1.2428 WP_000616243.1.24304 WP_000616243.1.24362 WP_000616243.1.24583 WP_000616243.1.24616 WP_000616243.1.24899 WP_000616243.1.24960 WP_000616243.1.25042 WP_000616243.1.25085 WP_000616243.1.25141 WP_000616243.1.25183 WP_000616243.1.25203 WP_000616243.1.2531 WP_000616243.1.25312 WP_000616243.1.25324 WP_000616243.1.25643 WP_000616243.1.25713 WP_000616243.1.25832 WP_000616243.1.25843 WP_000616243.1.25996 WP_000616243.1.26048 WP_000616243.1.26379 WP_000616243.1.26480 WP_000616243.1.26609 WP_000616243.1.26941 WP_000616243.1.27057 WP_000616243.1.27098 WP_000616243.1.2712 WP_000616243.1.27134 WP_000616243.1.27214 WP_000616243.1.27260 WP_000616243.1.27451 WP_000616243.1.27560 WP_000616243.1.27611 WP_000616243.1.27879 WP_000616243.1.27923 WP_000616243.1.27971 WP_000616243.1.28128 WP_000616243.1.28268 WP_000616243.1.28271 WP_000616243.1.28509 WP_000616243.1.28662 WP_000616243.1.28697 WP_000616243.1.28711 WP_000616243.1.28809 WP_000616243.1.28919 WP_000616243.1.28982 WP_000616243.1.28994 WP_000616243.1.29061 WP_000616243.1.29100 WP_000616243.1.29128 WP_000616243.1.29221 WP_000616243.1.29239 WP_000616243.1.2945 WP_000616243.1.29746 WP_000616243.1.30231 WP_000616243.1.30247 WP_000616243.1.3045 WP_000616243.1.30472 WP_000616243.1.30479 WP_000616243.1.30497 WP_000616243.1.30546 WP_000616243.1.30554 WP_000616243.1.30630 WP_000616243.1.30639 WP_000616243.1.30749 WP_000616243.1.30783 WP_000616243.1.30866 WP_000616243.1.31142 WP_000616243.1.31211 WP_000616243.1.31379 WP_000616243.1.31407 WP_000616243.1.31421 WP_000616243.1.31506 WP_000616243.1.31614 WP_000616243.1.31681 WP_000616243.1.3181 WP_000616243.1.31833 WP_000616243.1.31839 WP_000616243.1.31978 WP_000616243.1.32093 WP_000616243.1.3212 WP_000616243.1.32121 WP_000616243.1.32127 WP_000616243.1.32143 WP_000616243.1.32394 WP_000616243.1.32479 WP_000616243.1.32509 WP_000616243.1.32601 WP_000616243.1.32661 WP_000616243.1.32722 WP_000616243.1.32903 WP_000616243.1.32984 WP_000616243.1.33238 WP_000616243.1.33244 WP_000616243.1.33325 WP_000616243.1.33408 WP_000616243.1.33422 WP_000616243.1.33502 WP_000616243.1.33526 WP_000616243.1.33545 WP_000616243.1.33565 WP_000616243.1.33736 WP_000616243.1.33746 WP_000616243.1.33799 WP_000616243.1.33879 WP_000616243.1.33952 WP_000616243.1.33973 WP_000616243.1.33974 WP_000616243.1.3401 WP_000616243.1.34124 WP_000616243.1.34270 WP_000616243.1.34277 WP_000616243.1.34332 WP_000616243.1.34363 WP_000616243.1.34444 WP_000616243.1.34525 WP_000616243.1.34538 WP_000616243.1.34727 WP_000616243.1.34982 WP_000616243.1.34990 WP_000616243.1.34993 WP_000616243.1.35180 WP_000616243.1.35204 WP_000616243.1.35211 WP_000616243.1.35360 WP_000616243.1.35466 WP_000616243.1.35651 WP_000616243.1.35704 WP_000616243.1.35724 WP_000616243.1.35740 WP_000616243.1.35904 WP_000616243.1.35959 WP_000616243.1.36164 WP_000616243.1.36334 WP_000616243.1.36386 WP_000616243.1.36496 WP_000616243.1.36531 WP_000616243.1.3671 WP_000616243.1.36739 WP_000616243.1.36746 WP_000616243.1.36747 WP_000616243.1.36833 WP_000616243.1.37122 WP_000616243.1.3723 WP_000616243.1.37233 WP_000616243.1.37433 WP_000616243.1.37445 WP_000616243.1.37485 WP_000616243.1.37576 WP_000616243.1.37588 WP_000616243.1.37750 WP_000616243.1.3788 WP_000616243.1.37897 WP_000616243.1.37964 WP_000616243.1.38080 WP_000616243.1.38085 WP_000616243.1.38105 WP_000616243.1.3811 WP_000616243.1.3815 WP_000616243.1.38155 WP_000616243.1.38182 WP_000616243.1.38211 WP_000616243.1.38323 WP_000616243.1.38371 WP_000616243.1.38533 WP_000616243.1.38636 WP_000616243.1.38950 WP_000616243.1.38956 WP_000616243.1.39164 WP_000616243.1.39356 WP_000616243.1.39365 WP_000616243.1.39430 WP_000616243.1.39531 WP_000616243.1.39541 WP_000616243.1.39829 WP_000616243.1.39870 WP_000616243.1.39938 WP_000616243.1.39961 WP_000616243.1.39966 WP_000616243.1.39998 WP_000616243.1.40016 WP_000616243.1.40212 WP_000616243.1.40218 WP_000616243.1.40317 WP_000616243.1.40389 WP_000616243.1.40445 WP_000616243.1.40499 WP_000616243.1.40524 WP_000616243.1.406 WP_000616243.1.40666 WP_000616243.1.40712 WP_000616243.1.40815 WP_000616243.1.40833 WP_000616243.1.40898 WP_000616243.1.40912 WP_000616243.1.40937 WP_000616243.1.40965 WP_000616243.1.41206 WP_000616243.1.4126 WP_000616243.1.41368 WP_000616243.1.41436 WP_000616243.1.41530 WP_000616243.1.41556 WP_000616243.1.41782 WP_000616243.1.41900 WP_000616243.1.42022 WP_000616243.1.42033 WP_000616243.1.42073 WP_000616243.1.42113 WP_000616243.1.42159 WP_000616243.1.42209 WP_000616243.1.42214 WP_000616243.1.42233 WP_000616243.1.42318 WP_000616243.1.42376 WP_000616243.1.4242 WP_000616243.1.42547 WP_000616243.1.42770 WP_000616243.1.4282 WP_000616243.1.42879 WP_000616243.1.4290 WP_000616243.1.42936 WP_000616243.1.42987 WP_000616243.1.42989 WP_000616243.1.43035 WP_000616243.1.4306 WP_000616243.1.43270 WP_000616243.1.43444 WP_000616243.1.43473 WP_000616243.1.43622 WP_000616243.1.43720 WP_000616243.1.43925 WP_000616243.1.43989 WP_000616243.1.44088 WP_000616243.1.44096 WP_000616243.1.44100 WP_000616243.1.44115 WP_000616243.1.44162 WP_000616243.1.44166 WP_000616243.1.44211 WP_000616243.1.44324 WP_000616243.1.44365 WP_000616243.1.44458 WP_000616243.1.44558 WP_000616243.1.44610 WP_000616243.1.44724 WP_000616243.1.44849 WP_000616243.1.44854 WP_000616243.1.44923 WP_000616243.1.44960 WP_000616243.1.44970 WP_000616243.1.44980 WP_000616243.1.45025 WP_000616243.1.45116 WP_000616243.1.4516 WP_000616243.1.45208 WP_000616243.1.45246 WP_000616243.1.45313 WP_000616243.1.45329 WP_000616243.1.4549 WP_000616243.1.45581 WP_000616243.1.45595 WP_000616243.1.4574 WP_000616243.1.45752 WP_000616243.1.4593 WP_000616243.1.45933 WP_000616243.1.45945 WP_000616243.1.46026 WP_000616243.1.46186 WP_000616243.1.46213 WP_000616243.1.46325 WP_000616243.1.46441 WP_000616243.1.46573 WP_000616243.1.46582 WP_000616243.1.4670 WP_000616243.1.46802 WP_000616243.1.46820 WP_000616243.1.46909 WP_000616243.1.46932 WP_000616243.1.47038 WP_000616243.1.47186 WP_000616243.1.4722 WP_000616243.1.47224 WP_000616243.1.47322 WP_000616243.1.47386 WP_000616243.1.47414 WP_000616243.1.47496 WP_000616243.1.47634 WP_000616243.1.47646 WP_000616243.1.47673 WP_000616243.1.4772 WP_000616243.1.47734 WP_000616243.1.47740 WP_000616243.1.47764 WP_000616243.1.47765 WP_000616243.1.47791 WP_000616243.1.48040 WP_000616243.1.48048 WP_000616243.1.48080 WP_000616243.1.48096 WP_000616243.1.48111 WP_000616243.1.48194 WP_000616243.1.48290 WP_000616243.1.48353 WP_000616243.1.48371 WP_000616243.1.48477 WP_000616243.1.48522 WP_000616243.1.486 WP_000616243.1.4871 WP_000616243.1.48847 WP_000616243.1.48860 WP_000616243.1.48953 WP_000616243.1.48974 WP_000616243.1.49009 WP_000616243.1.49236 WP_000616243.1.49363 WP_000616243.1.49531 WP_000616243.1.49537 WP_000616243.1.49645 WP_000616243.1.49661 WP_000616243.1.497 WP_000616243.1.49733 WP_000616243.1.49740 WP_000616243.1.49768 WP_000616243.1.49883 WP_000616243.1.50078 WP_000616243.1.5017 WP_000616243.1.50262 WP_000616243.1.50266 WP_000616243.1.50564 WP_000616243.1.50579 WP_000616243.1.51042 WP_000616243.1.51172 WP_000616243.1.51255 WP_000616243.1.51300 WP_000616243.1.51325 WP_000616243.1.51380 WP_000616243.1.51441 WP_000616243.1.5146 WP_000616243.1.51495 WP_000616243.1.51539 WP_000616243.1.51548 WP_000616243.1.51552 WP_000616243.1.51607 WP_000616243.1.51784 WP_000616243.1.51968 WP_000616243.1.52002 WP_000616243.1.52020 WP_000616243.1.52062 WP_000616243.1.52076 WP_000616243.1.52127 WP_000616243.1.52186 WP_000616243.1.52211 WP_000616243.1.52214 WP_000616243.1.52243 WP_000616243.1.52305 WP_000616243.1.52399 WP_000616243.1.52421 WP_000616243.1.52492 WP_000616243.1.52544 WP_000616243.1.52558 WP_000616243.1.5272 WP_000616243.1.52774 WP_000616243.1.52844 WP_000616243.1.52853 WP_000616243.1.52895 WP_000616243.1.53012 WP_000616243.1.53110 WP_000616243.1.53377 WP_000616243.1.53428 WP_000616243.1.53482 WP_000616243.1.53545 WP_000616243.1.53769 WP_000616243.1.53931 WP_000616243.1.53972 WP_000616243.1.53994 WP_000616243.1.54002 WP_000616243.1.54263 WP_000616243.1.54344 WP_000616243.1.54476 WP_000616243.1.54507 WP_000616243.1.54602 WP_000616243.1.54605 WP_000616243.1.5461 WP_000616243.1.54617 WP_000616243.1.54620 WP_000616243.1.5470 WP_000616243.1.54769 WP_000616243.1.54981 WP_000616243.1.55003 WP_000616243.1.55123 WP_000616243.1.55203 WP_000616243.1.55466 WP_000616243.1.55529 WP_000616243.1.55551 WP_000616243.1.55571 WP_000616243.1.55574 WP_000616243.1.55629 WP_000616243.1.55676 WP_000616243.1.55825 WP_000616243.1.55868 WP_000616243.1.5614 WP_000616243.1.56164 WP_000616243.1.56197 WP_000616243.1.56285 WP_000616243.1.56436 WP_000616243.1.56846 WP_000616243.1.56932 WP_000616243.1.56934 WP_000616243.1.56978 WP_000616243.1.56980 WP_000616243.1.57181 WP_000616243.1.57386 WP_000616243.1.57401 WP_000616243.1.57403 WP_000616243.1.57410 WP_000616243.1.57432 WP_000616243.1.57719 WP_000616243.1.57846 WP_000616243.1.5786 WP_000616243.1.57904 WP_000616243.1.58080 WP_000616243.1.58232 WP_000616243.1.58401 WP_000616243.1.5842 WP_000616243.1.58420 WP_000616243.1.58429 WP_000616243.1.58440 WP_000616243.1.58867 WP_000616243.1.58940 WP_000616243.1.58976 WP_000616243.1.59024 WP_000616243.1.59035 WP_000616243.1.59306 WP_000616243.1.59407 WP_000616243.1.59513 WP_000616243.1.59590 WP_000616243.1.59615 WP_000616243.1.5965 WP_000616243.1.59912 WP_000616243.1.59998 WP_000616243.1.6002 WP_000616243.1.60031 WP_000616243.1.60151 WP_000616243.1.60343 WP_000616243.1.60477 WP_000616243.1.60498 WP_000616243.1.60550 WP_000616243.1.60576 WP_000616243.1.6061 WP_000616243.1.6066 WP_000616243.1.60717 WP_000616243.1.60764 WP_000616243.1.60895 WP_000616243.1.60901 WP_000616243.1.6106 WP_000616243.1.61096 WP_000616243.1.61170 WP_000616243.1.61181 WP_000616243.1.61241 WP_000616243.1.61505 WP_000616243.1.61517 WP_000616243.1.61663 WP_000616243.1.61779 WP_000616243.1.61822 WP_000616243.1.61858 WP_000616243.1.61949 WP_000616243.1.62099 WP_000616243.1.62612 WP_000616243.1.62642 WP_000616243.1.62668 WP_000616243.1.62735 WP_000616243.1.62812 WP_000616243.1.62840 WP_000616243.1.62919 WP_000616243.1.62989 WP_000616243.1.63167 WP_000616243.1.6337 WP_000616243.1.63453 WP_000616243.1.63721 WP_000616243.1.64040 WP_000616243.1.64080 WP_000616243.1.64285 WP_000616243.1.6431 WP_000616243.1.64448 WP_000616243.1.647 WP_000616243.1.64784 WP_000616243.1.64789 WP_000616243.1.64912 WP_000616243.1.6499 WP_000616243.1.65256 WP_000616243.1.65271 WP_000616243.1.65364 WP_000616243.1.65415 WP_000616243.1.65596 WP_000616243.1.65912 WP_000616243.1.65961 WP_000616243.1.66050 WP_000616243.1.66104 WP_000616243.1.66127 WP_000616243.1.66251 WP_000616243.1.66280 WP_000616243.1.66327 WP_000616243.1.6635 WP_000616243.1.66387 WP_000616243.1.66389 WP_000616243.1.66395 WP_000616243.1.66501 WP_000616243.1.6654 WP_000616243.1.66559 WP_000616243.1.66624 WP_000616243.1.6665 WP_000616243.1.66700 WP_000616243.1.66719 WP_000616243.1.66933 WP_000616243.1.67022 WP_000616243.1.67200 WP_000616243.1.67415 WP_000616243.1.67468 WP_000616243.1.67538 WP_000616243.1.67553 WP_000616243.1.67786 WP_000616243.1.67787 WP_000616243.1.67861 WP_000616243.1.67975 WP_000616243.1.67990 WP_000616243.1.68008 WP_000616243.1.6803 WP_000616243.1.6814 WP_000616243.1.68170 WP_000616243.1.68215 WP_000616243.1.68283 WP_000616243.1.68341 WP_000616243.1.68534 WP_000616243.1.68697 WP_000616243.1.68711 WP_000616243.1.68915 WP_000616243.1.68989 WP_000616243.1.6916 WP_000616243.1.6923 WP_000616243.1.69247 WP_000616243.1.69261 WP_000616243.1.69303 WP_000616243.1.69305 WP_000616243.1.6945 WP_000616243.1.69646 WP_000616243.1.69803 WP_000616243.1.6993 WP_000616243.1.70407 WP_000616243.1.70578 WP_000616243.1.70619 WP_000616243.1.70767 WP_000616243.1.70794 WP_000616243.1.70880 WP_000616243.1.71024 WP_000616243.1.71159 WP_000616243.1.71199 WP_000616243.1.71229 WP_000616243.1.71285 WP_000616243.1.71312 WP_000616243.1.71323 WP_000616243.1.71397 WP_000616243.1.71480 WP_000616243.1.71522 WP_000616243.1.71632 WP_000616243.1.71690 WP_000616243.1.71837 WP_000616243.1.71938 WP_000616243.1.71975 WP_000616243.1.71993 WP_000616243.1.7210 WP_000616243.1.72157 WP_000616243.1.72184 WP_000616243.1.72237 WP_000616243.1.72337 WP_000616243.1.72397 WP_000616243.1.72431 WP_000616243.1.72485 WP_000616243.1.72511 WP_000616243.1.72537 WP_000616243.1.72544 WP_000616243.1.72616 WP_000616243.1.72745 WP_000616243.1.72747 WP_000616243.1.72860 WP_000616243.1.72869 WP_000616243.1.72910 WP_000616243.1.73085 WP_000616243.1.73217 WP_000616243.1.73292 WP_000616243.1.73295 WP_000616243.1.73385 WP_000616243.1.73524 WP_000616243.1.73565 WP_000616243.1.73604 WP_000616243.1.73717 WP_000616243.1.7376 WP_000616243.1.73835 WP_000616243.1.73844 WP_000616243.1.73859 WP_000616243.1.73942 WP_000616243.1.7411 WP_000616243.1.74184 WP_000616243.1.74309 WP_000616243.1.74365 WP_000616243.1.74445 WP_000616243.1.74520 WP_000616243.1.74528 WP_000616243.1.74625 WP_000616243.1.74688 WP_000616243.1.74691 WP_000616243.1.7475 WP_000616243.1.74962 WP_000616243.1.74998 WP_000616243.1.75139 WP_000616243.1.75243 WP_000616243.1.75272 WP_000616243.1.75367 WP_000616243.1.75428 WP_000616243.1.75491 WP_000616243.1.75515 WP_000616243.1.75537 WP_000616243.1.75612 WP_000616243.1.75644 WP_000616243.1.75653 WP_000616243.1.75679 WP_000616243.1.75699 WP_000616243.1.75735 WP_000616243.1.75995 WP_000616243.1.76039 WP_000616243.1.76196 WP_000616243.1.76312 WP_000616243.1.76446 WP_000616243.1.76462 WP_000616243.1.76701 WP_000616243.1.76707 WP_000616243.1.76712 WP_000616243.1.76815 WP_000616243.1.76948 WP_000616243.1.77214 WP_000616243.1.77358 WP_000616243.1.77470 WP_000616243.1.77595 WP_000616243.1.77636 WP_000616243.1.77648 WP_000616243.1.77767 WP_000616243.1.77768 WP_000616243.1.77876 WP_000616243.1.78000 WP_000616243.1.78007 WP_000616243.1.78089 WP_000616243.1.78196 WP_000616243.1.78321 WP_000616243.1.78413 WP_000616243.1.7847 WP_000616243.1.78481 WP_000616243.1.78583 WP_000616243.1.78612 WP_000616243.1.78615 WP_000616243.1.78750 WP_000616243.1.78791 WP_000616243.1.78953 WP_000616243.1.7896 WP_000616243.1.79004 WP_000616243.1.79086 WP_000616243.1.79306 WP_000616243.1.79312 WP_000616243.1.79478 WP_000616243.1.79505 WP_000616243.1.79558 WP_000616243.1.79685 WP_000616243.1.79764 WP_000616243.1.79840 WP_000616243.1.7987 WP_000616243.1.79871 WP_000616243.1.79931 WP_000616243.1.79984 WP_000616243.1.80136 WP_000616243.1.80255 WP_000616243.1.80320 WP_000616243.1.80428 WP_000616243.1.80440 WP_000616243.1.80444 WP_000616243.1.80517 WP_000616243.1.8057 WP_000616243.1.80612 WP_000616243.1.80768 WP_000616243.1.80804 WP_000616243.1.80884 WP_000616243.1.8090 WP_000616243.1.81034 WP_000616243.1.81127 WP_000616243.1.81313 WP_000616243.1.81576 WP_000616243.1.81577 WP_000616243.1.81715 WP_000616243.1.81723 WP_000616243.1.81806 WP_000616243.1.81832 WP_000616243.1.81935 WP_000616243.1.81939 WP_000616243.1.82316 WP_000616243.1.8235 WP_000616243.1.82439 WP_000616243.1.82647 WP_000616243.1.82700 WP_000616243.1.82715 WP_000616243.1.82754 WP_000616243.1.82853 WP_000616243.1.83020 WP_000616243.1.8308 WP_000616243.1.83097 WP_000616243.1.831 WP_000616243.1.83140 WP_000616243.1.83144 WP_000616243.1.83205 WP_000616243.1.83224 WP_000616243.1.83415 WP_000616243.1.8345 WP_000616243.1.83537 WP_000616243.1.83735 WP_000616243.1.83941 WP_000616243.1.8411 WP_000616243.1.84210 WP_000616243.1.84298 WP_000616243.1.84405 WP_000616243.1.84410 WP_000616243.1.8444 WP_000616243.1.84534 WP_000616243.1.84584 WP_000616243.1.84697 WP_000616243.1.84738 WP_000616243.1.84740 WP_000616243.1.84877 WP_000616243.1.84972 WP_000616243.1.84977 WP_000616243.1.84989 WP_000616243.1.84994 WP_000616243.1.85002 WP_000616243.1.85216 WP_000616243.1.85247 WP_000616243.1.85255 WP_000616243.1.85260 WP_000616243.1.85310 WP_000616243.1.8560 WP_000616243.1.85621 WP_000616243.1.85752 WP_000616243.1.85857 WP_000616243.1.8592 WP_000616243.1.85948 WP_000616243.1.86189 WP_000616243.1.8621 WP_000616243.1.86276 WP_000616243.1.86412 WP_000616243.1.86452 WP_000616243.1.86461 WP_000616243.1.86475 WP_000616243.1.86609 WP_000616243.1.86691 WP_000616243.1.86787 WP_000616243.1.86848 WP_000616243.1.86959 WP_000616243.1.86997 WP_000616243.1.87199 WP_000616243.1.87389 WP_000616243.1.87563 WP_000616243.1.87574 WP_000616243.1.87610 WP_000616243.1.87655 WP_000616243.1.87721 WP_000616243.1.87857 WP_000616243.1.87914 WP_000616243.1.88017 WP_000616243.1.88110 WP_000616243.1.88301 WP_000616243.1.88434 WP_000616243.1.88607 WP_000616243.1.88710 WP_000616243.1.88711 WP_000616243.1.8879 WP_000616243.1.88834 WP_000616243.1.88950 WP_000616243.1.89090 WP_000616243.1.89099 WP_000616243.1.89416 WP_000616243.1.89458 WP_000616243.1.89468 WP_000616243.1.89471 WP_000616243.1.89674 WP_000616243.1.89899 WP_000616243.1.89923 WP_000616243.1.89927 WP_000616243.1.89977 WP_000616243.1.90017 WP_000616243.1.90078 WP_000616243.1.90168 WP_000616243.1.90256 WP_000616243.1.90358 WP_000616243.1.9036 WP_000616243.1.90389 WP_000616243.1.90511 WP_000616243.1.90520 WP_000616243.1.90536 WP_000616243.1.90799 WP_000616243.1.90828 WP_000616243.1.90865 WP_000616243.1.90924 WP_000616243.1.90951 WP_000616243.1.91018 WP_000616243.1.91170 WP_000616243.1.91277 WP_000616243.1.91341 WP_000616243.1.91445 WP_000616243.1.91462 WP_000616243.1.915 WP_000616243.1.91551 WP_000616243.1.91640 WP_000616243.1.9169 WP_000616243.1.91739 WP_000616243.1.91994 WP_000616243.1.9215 WP_000616243.1.92161 WP_000616243.1.92224 WP_000616243.1.92323 WP_000616243.1.92361 WP_000616243.1.92568 WP_000616243.1.92614 WP_000616243.1.92615 WP_000616243.1.92742 WP_000616243.1.92792 WP_000616243.1.92845 WP_000616243.1.92865 WP_000616243.1.92943 WP_000616243.1.93019 WP_000616243.1.93048 WP_000616243.1.93054 WP_000616243.1.93175 WP_000616243.1.93276 WP_000616243.1.93312 WP_000616243.1.93634 WP_000616243.1.93652 WP_000616243.1.93673 WP_000616243.1.93755 WP_000616243.1.93911 WP_000616243.1.93971 WP_000616243.1.94025 WP_000616243.1.94057 WP_000616243.1.94176 WP_000616243.1.94187 WP_000616243.1.94271 WP_000616243.1.94388 WP_000616243.1.94445 WP_000616243.1.94542 WP_000616243.1.9457 WP_000616243.1.94626 WP_000616243.1.94695 WP_000616243.1.94738 WP_000616243.1.94764 WP_000616243.1.948 WP_000616243.1.9489 WP_000616243.1.94898 WP_000616243.1.94935 WP_000616243.1.94938 WP_000616243.1.94949 WP_000616243.1.95037 WP_000616243.1.95332 WP_000616243.1.95395 WP_000616243.1.95595 WP_000616243.1.95827 WP_000616243.1.95849 WP_000616243.1.95919 WP_000616243.1.96215 WP_000616243.1.96279 WP_000616243.1.96299 WP_000616243.1.96303 WP_000616243.1.96339 WP_000616243.1.96394 WP_000616243.1.96417 WP_000616243.1.96479 WP_000616243.1.96984 WP_000616243.1.97011 WP_000616243.1.97123 WP_000616243.1.97231 WP_000616243.1.97418 WP_000616243.1.9747 WP_000616243.1.97667 WP_000616243.1.97825 WP_000616243.1.97930 WP_000616243.1.98235 WP_000616243.1.98241 WP_000616243.1.98294 WP_000616243.1.98424 WP_000616243.1.98442 WP_000616243.1.98477 WP_000616243.1.98628 WP_000616243.1.9864 WP_000616243.1.98776 WP_000616243.1.99310 WP_000616243.1.99319 WP_000616243.1.99534 WP_000616243.1.99602 WP_000616243.1.99603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]