SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1e3o_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1e3o_C
Domain Number 1 Region: 5-74
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.41e-63
Family POU-specific domain 0.0026
Further Details:      
 
Domain Number 2 Region: 80-159
Classification Level Classification E-value
Superfamily Homeodomain-like 8.56e-19
Family Homeodomain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1e3o_C
Sequence length 160
Comment mol:protein length:160 OCTAMER-BINDING TRANSCRIPTION FACTOR 1
Sequence
eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
sklkpllekwlndaeanlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksf
menqkptseditliaeqlnmekevirvwfsnrrqkekrin
Download sequence
Identical sequences 1e3oC 1e3o_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]