SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jc4_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jc4_B
Domain Number 1 Region: 10-142
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 5.88e-40
Family Methylmalonyl-CoA epimerase 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1jc4_B
Sequence length 148
Comment mol:protein length:148 Methylmalonyl-CoA epimerase
Sequence
MSNEDLFICIDHVAYACPDADEASKYYQETFGWHELHREENPEQGVVEIMMAPAAKLTEH
MTQVQVMAPLNDESTVAKWLAKHNGRAGLHHMAWRVDDIDAVSATLRERGVQLLYDEPKL
GTGGNRINFMHPKSGKGVLIELTQYPKN
Download sequence
Identical sequences A0A068VRZ1 A0A0A8PSW2 D7GDH1 Q8VQN0
cath|current|1jc5A00/3-147 cath|current|1jc5B00/1-147 cath|current|1jc5C00/3-147 cath|current|1jc5D00/4-148 cath|current|1jc5E00/4-148 cath|current|1jc5F00/4-147 1jc4A WP_013160962.1.100606 WP_013160962.1.12274 WP_013160962.1.1730 WP_013160962.1.29465 WP_013160962.1.29476 WP_013160962.1.30516 WP_013160962.1.35670 WP_013160962.1.36376 WP_013160962.1.45095 WP_013160962.1.45169 WP_013160962.1.45898 WP_013160962.1.47803 WP_013160962.1.58851 WP_013160962.1.58907 WP_013160962.1.67466 WP_013160962.1.69467 WP_013160962.1.80812 WP_013160962.1.82752 WP_013160962.1.88748 WP_013160962.1.92251 WP_013160962.1.94151 WP_013160962.1.97062 gi|297626255|ref|YP_003688018.1| 1jc4_A 1jc4_B 1jc4_C 1jc4_D 1jc5_A 1jc5_B 1jc5_C 1jc5_D 1jc5_E 1jc5_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]