SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1l1m_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1l1m_B
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.42e-26
Family GalR/LacI-like bacterial regulator 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1l1m_B
Sequence length 62
Comment mol:protein length:62 Lactose operon repressor
Sequence
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
sl
Download sequence
Identical sequences 000134874|e2keiA1|101.1.4.15|A:1-62 000363671|e2keiB1|101.1.4.15|B:1-62 000363672|e2kejA1|101.1.4.15|A:1-62 000363673|e2kejB1|101.1.4.15|B:1-62 000363674|e2kekA1|101.1.4.15|A:1-62 000363675|e2kekB1|101.1.4.15|B:1-62 cath|current|1l1mA00/1-62 cath|current|1l1mB00/1-62 cath|current|1oslA00/1-62 cath|current|1oslB00/1-62 cath|current|2keiA00/1-62 cath|current|2keiB00/1-62 cath|current|2kejA00/1-62 cath|current|2kejB00/1-62 cath|current|2kekA00/1-62 cath|current|2kekB00/1-62 d1l1ma_ d1l1mb_ d1osla_ d1oslb_ d2keia_ d2keib_ d2keja_ d2kejb_ d2keka_ d2kekb_ 1l1m_A 1l1m_B 1osl_A 1osl_B 2kei_A 2kei_B 2kej_A 2kej_B 2kek_A 2kek_B 1l1mA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]