SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1lcd_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lcd_A
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.25e-26
Family GalR/LacI-like bacterial regulator 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1lcd_A
Sequence length 51
Comment mol:protein length:51 Lac Repressor
Sequence
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnr
Download sequence
Identical sequences 1lcdA 1lcc_A 1lcd_A cath|current|1lccA00/1-51 cath|current|1lcdA00/1-51 d1lcca_ d1lcda_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]