SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1m8n_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1m8n_C
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily An insect antifreeze protein 4.73e-61
Family An insect antifreeze protein 0.000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1m8n_C
Sequence length 121
Comment mol:protein length:121 Antifreeze protein isoform 501
Sequence
dgtcvntnsqitansqcvkstatncyidnsqlvdtsictrsqysdanvkksvttdcnidk
sqvylttctgsqyngiyirsstttgtsisgpgcsistctitrgvatpaaackisgcslsa
m
Download sequence
Identical sequences 1m8nA 1m8n_A 1m8n_B 1m8n_C 1m8n_D 1z2f_A cath|current|1m8nA00/2-121 cath|current|1m8nB00/3-121 cath|current|1m8nC00/3-121 cath|current|1m8nD00/2-121 cath|current|1z2fA00/1-121 d1z2fa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]