SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rio_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rio_B
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.25e-20
Family Phage repressors 0.0000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1rio_B
Sequence length 98
Comment mol:protein length:98 Repressor protein CI
Sequence
mstkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalna
ynaallakilkvsveefspsiareiyemyeavhhhhhh
Download sequence
Identical sequences 1rio_A 1rio_B 1rioA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]