SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rpe_L from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rpe_L
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.69e-17
Family Phage repressors 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1rpe_L
Sequence length 69
Comment mol:protein length:69 PROTEIN (434 REPRESSOR)
Sequence
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngtsdsnvr
Download sequence
Identical sequences cath|current|1perL00/1-63 cath|current|1perR00/1-63 cath|current|1praA00/1-69 cath|current|1r69A00/1-63 cath|current|1rpeL00/1-63 cath|current|1rpeR00/1-63 cath|current|2or1L00/1-63 cath|current|2or1R00/1-63 d1praa_ 1r69A 1per_L 1per_R 1pra_A 1r69_A 1rpe_L 1rpe_R 2or1_L 2or1_R

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]