SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1s7e_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1s7e_A
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.06e-36
Family CUT domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 95-147
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000153
Family Homeodomain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1s7e_A
Sequence length 147
Comment mol:protein length:147 Hepatocyte nuclear factor 6
Sequence
eintkevaqrittelkrysipqaifaqrvlcrsqgtlsdllrnpkpwsklksgretfrrm
wkwlqepefqrmsalrlaackrkeqehgkdrgntpkkprlvftdvqrrtlhaifkenkrp
skelqitisqqlglelstvsnffmnar
Download sequence
Identical sequences 1s7e_A 1s7eA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]