SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xrk_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xrk_B
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 7.12e-19
Family Antibiotic resistance proteins 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1xrk_B
Sequence length 124
Comment mol:protein length:124 Bleomycin resistance protein
Sequence
makltsavpvltardvaeavefwtdrlgfsrvfveddfagvvrddvtlfisavqdqvvpd
ntqawvwvrgldelyaewsevvstnfrdasgpamteiveqpwgrefalrdpagncvhfva
eeqd
Download sequence
Identical sequences cath|current|1xrkA00/2-121 cath|current|1xrkB00/2-122 1xrk_A 1xrk_B 1xrkA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]