SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1y7y_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1y7y_A
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.08e-18
Family SinR domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1y7y_A
Sequence length 74
Comment mol:protein length:74 C.AhdI
Sequence
MQSHHDHYADLVKFGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILK
LATALDIEPRELFC
Download sequence
Identical sequences Q7X0F0
1y7y_A 1y7y_B 1y7yA cath|current|1y7yA00/5-73 cath|current|1y7yB00/8-73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]