SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1zz8_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zz8_A
Domain Number 1 Region: 78-197
Classification Level Classification E-value
Superfamily RmlC-like cupins 5.15e-21
Family TM1459-like 0.000000754
Further Details:      
 
Domain Number 2 Region: 9-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000345
Family SinR domain-like 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1zz8_A
Sequence length 198
Comment mol:protein length:198 Hydroxypropylphosphonic Acid Epoxidase
Sequence
MSNTKTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIA
HVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPL
VVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPH
AFTAAKGTGSAKLIAVNF
Download sequence
Identical sequences A0A0L8KLT8 Q56185
1zz6_A 1zz6_B 1zz7_A 1zz7_B 1zz8_A 1zz8_B 1zz8_C 1zz9_A 1zz9_B 1zz9_C 1zzb_A 1zzb_B 1zzc_A 1zzc_B 2bnm_A 2bnm_B 2bnn_A 2bnn_B 2bno_A 2bno_B 3scf_A 3scf_B 3scf_C 3scg_A 3scg_B 3scg_C 3sch_A 3sch_B 4j1w_A 4j1w_B 4j1w_C 2bnmA WP_033205181.1.28093 WP_033205181.1.63210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]