SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2awi_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2awi_C
Domain Number 1 Region: 72-301
Classification Level Classification E-value
Superfamily TPR-like 4.11e-85
Family PrgX C-terminal domain-like 0.000000000629
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000412
Family PrgX N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2awi_C
Sequence length 317
Comment mol:protein length:317 PrgX
Sequence
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
nyvaiennpipeikeqs
Download sequence
Identical sequences 2awi_A 2awi_B 2awi_C 2awi_D 2awi_E 2awi_F 2awi_G 2awi_H 2awi_I 2awi_J 2awi_K 2awi_L 2axv_A 2axv_B 2axv_C 2axv_D 2awiA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]