SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2axu_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2axu_A
Domain Number 1 Region: 72-301
Classification Level Classification E-value
Superfamily TPR-like 1.31e-86
Family PrgX C-terminal domain-like 0.000000000702
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000412
Family PrgX N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2axu_A
Sequence length 317
Comment mol:protein length:317 PrgX
Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFE
ILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIA
HHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVD
SFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLK
QIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYE
NYVAIENNPIPEIKEQS
Download sequence
Identical sequences A0A0E9EKJ9 A0A0M2APM2 E0HAB5 E6GI54 Q04114 S4EPL5 S4FSI2
2axuA 2aw6_A 2aw6_B 2axu_A 2axu_B 2axu_C 2axu_D 2axu_E 2axu_F 2axu_G 2axu_H 2axu_I 2axu_J 2axu_K 2axu_L 2axz_A 2axz_B 2axz_C 2axz_D 2grl_A 2grl_B 2grl_C 2grl_D gi|384519627|ref|YP_005706931.1| gi|217388431|ref|YP_002333461.1|NC_011642 gi|384519627|ref|YP_005706931.1|NC_017313 gi|58616133|ref|YP_195768.1|NC_006827 WP_002366018.1.101808 WP_002366018.1.10758 WP_002366018.1.11048 WP_002366018.1.14485 WP_002366018.1.14750 WP_002366018.1.15224 WP_002366018.1.17682 WP_002366018.1.24526 WP_002366018.1.26187 WP_002366018.1.2801 WP_002366018.1.28428 WP_002366018.1.30275 WP_002366018.1.33581 WP_002366018.1.33851 WP_002366018.1.34766 WP_002366018.1.36209 WP_002366018.1.36880 WP_002366018.1.36900 WP_002366018.1.37885 WP_002366018.1.43540 WP_002366018.1.43994 WP_002366018.1.44185 WP_002366018.1.44501 WP_002366018.1.45484 WP_002366018.1.46113 WP_002366018.1.48676 WP_002366018.1.49914 WP_002366018.1.5113 WP_002366018.1.51694 WP_002366018.1.53279 WP_002366018.1.53989 WP_002366018.1.54277 WP_002366018.1.57705 WP_002366018.1.5872 WP_002366018.1.66403 WP_002366018.1.6682 WP_002366018.1.67615 WP_002366018.1.68746 WP_002366018.1.6893 WP_002366018.1.71406 WP_002366018.1.73817 WP_002366018.1.74362 WP_002366018.1.74389 WP_002366018.1.80396 WP_002366018.1.81991 WP_002366018.1.83032 WP_002366018.1.83649 WP_002366018.1.85945 WP_002366018.1.85963 WP_002366018.1.94506 WP_002366018.1.98078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]