SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ict_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ict_A
Domain Number 1 Region: 9-88
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.42e-24
Family SinR domain-like 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2ict_A
Sequence length 94
Comment mol:protein length:94 antitoxin higa
Sequence
MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI
GSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ
Download sequence
Identical sequences A0A024KWC0 A0A026V504 A0A027THK8 A0A027ZG75 A0A028E0Q7 A0A029IVH2 A0A062YA12 A0A064TGX4 A0A069XGD5 A0A070FRU7 A0A070SND5 A0A070UI06 A0A073FYE2 A0A073HJX8 A0A073UGE2 A0A074I0J8 A0A080FWY1 A0A080IY41 A0A0A8U7G9 A0A0E0TZC1 A0A0E0V4K7 A0A0E0Y2X2 A0A0E1LX59 A0A0E1SZ22 A0A0E2L5K1 A0A0E2TT39 A0A0H3EJK3 A0A0I3DZF4 A0A0J3VEW6 A0A0M7PN60 A0A0S3MVW1 A0A125X4K1 A0A140N994 A0A142H2T5 A0A163XFH8 A0A192C6P5 A0A1E2VT08 A0A1E3MYH4 A0A1S6TBC0 A0A1S9KD61 A0A1X3I794 A0A1X3JVR4 A0A1X3KAT4 A0A1X3KSQ6 A0A1X3LY49 A0A1X3MD98 A0A222QKZ1 A0A237FXD2 A0A2A2XSY1 A0A2I8C1R9 A7ZLR9 B1EM12 B1LFE0 B2U1M0 B6IAM9 C8U8F0 C8UPR8 D3GRL0 D6IAH3 D7X2V7 D7XVX7 D7XZW4 D7ZGL0 D8ABJ1 E0J6E4 E1IT46 E1JCP2 E6BQP7 E7SG39 E7TEL8 E9XKD6 E9Z0X5 F0JQ57 F4V1Y7 G0FFM8 H4UIX1 I0VMP6 I2RNK1 I2S3N0 I2ST46 I2UGC7 I2WAF8 I2WMY2 I2XE65 I4SHK0 I6EAV3 I6FX01 K4VWI8 K4WH35 L2V2F5 L2VYA6 L2XR80 L3P7U6 L3Q545 L3QMD4 L4JB00 M9GIN6 P67699 P67700 Q1RBU2 R8YHD4 S0W2Q7 S0WXC5 S0YDE3 S0ZG90 S1C8A3 S1DAR6 S1EMF4 S1F9Z7 S1GXM9 S1IB63 S1IWN9 S1LY14 S1PAQ1 T5V0Q7 T6AU96 T6I5V6 T6MTE0 T8K9B7 T9B5Z3 T9E5X1 T9TUR1 U9YCE1 U9YNB4 U9ZTR4 V0A135 V0SRU8 V0UMG0 V0YR17 V0YTK1 V2RC44 V2UP53 V6FW93 V8FGE0 V8K0H6 W0AMK7 W1BD98 W1EX84 W8ZS27
gi|387607063|ref|YP_006095919.1| gi|222156220|ref|YP_002556359.1| 199310.c1909 316385.ECDH10B_1608 331111.EcE24377A_1659 331112.EcHS_A1562 344609.SbBS512_E1740 362663.ECP_1478 364106.UTI89_C1694 409438.ECSE_1566 439855.EcSMS35_1697 469008.ECBD_2162 481805.EcolC_2180 511145.b1477 573235.ECO26_2075 585395.ECO103_1606 585396.ECO111_1867 595496.BWG_1298 gi|386634126|ref|YP_006153845.1| gi|386604525|ref|YP_006110825.1| gi|387616800|ref|YP_006119822.1| gi|91210717|ref|YP_540703.1| gi|157159120|ref|YP_001462748.1| gi|260843784|ref|YP_003221562.1| gi|170020192|ref|YP_001725146.1| d2icta_ gi|410482713|ref|YP_006770259.1| gi|407482163|ref|YP_006779312.1| gi|378713120|ref|YP_005278013.1| gi|170081148|ref|YP_001730468.1| gi|386613976|ref|YP_006133642.1| gi|260867917|ref|YP_003234319.1| gi|378713120|ref|YP_005278013.1| gi|386621184|ref|YP_006140764.1| gi|556551543|ref|YP_008721675.1| gi|544575950|ref|YP_008571474.1| gi|407469174|ref|YP_006784384.1| NP_415994.4.90541 WP_000781370.1.1000 WP_000781370.1.100014 WP_000781370.1.100044 WP_000781370.1.100063 WP_000781370.1.100066 WP_000781370.1.100085 WP_000781370.1.100111 WP_000781370.1.100116 WP_000781370.1.100135 WP_000781370.1.100138 WP_000781370.1.100151 WP_000781370.1.100159 WP_000781370.1.100185 WP_000781370.1.100194 WP_000781370.1.100220 WP_000781370.1.100227 WP_000781370.1.100251 WP_000781370.1.100252 WP_000781370.1.100281 WP_000781370.1.100283 WP_000781370.1.100285 WP_000781370.1.100304 WP_000781370.1.100306 WP_000781370.1.100315 WP_000781370.1.10034 WP_000781370.1.100346 WP_000781370.1.100389 WP_000781370.1.100425 WP_000781370.1.100441 WP_000781370.1.100444 WP_000781370.1.100447 WP_000781370.1.100448 WP_000781370.1.100451 WP_000781370.1.100474 WP_000781370.1.10048 WP_000781370.1.100496 WP_000781370.1.100499 WP_000781370.1.10051 WP_000781370.1.100531 WP_000781370.1.100543 WP_000781370.1.100571 WP_000781370.1.100573 WP_000781370.1.100614 WP_000781370.1.100667 WP_000781370.1.10067 WP_000781370.1.10068 WP_000781370.1.100685 WP_000781370.1.100688 WP_000781370.1.100689 WP_000781370.1.100718 WP_000781370.1.100725 WP_000781370.1.100735 WP_000781370.1.100738 WP_000781370.1.100752 WP_000781370.1.100758 WP_000781370.1.100778 WP_000781370.1.100796 WP_000781370.1.10080 WP_000781370.1.100824 WP_000781370.1.100836 WP_000781370.1.100851 WP_000781370.1.100852 WP_000781370.1.10086 WP_000781370.1.100867 WP_000781370.1.100868 WP_000781370.1.100898 WP_000781370.1.100916 WP_000781370.1.100928 WP_000781370.1.100933 WP_000781370.1.10094 WP_000781370.1.100959 WP_000781370.1.100990 WP_000781370.1.10100 WP_000781370.1.101033 WP_000781370.1.101052 WP_000781370.1.101087 WP_000781370.1.101096 WP_000781370.1.1011 WP_000781370.1.101102 WP_000781370.1.101110 WP_000781370.1.101121 WP_000781370.1.101148 WP_000781370.1.101152 WP_000781370.1.101157 WP_000781370.1.101158 WP_000781370.1.101175 WP_000781370.1.101186 WP_000781370.1.101214 WP_000781370.1.101216 WP_000781370.1.101255 WP_000781370.1.101257 WP_000781370.1.10126 WP_000781370.1.101282 WP_000781370.1.101289 WP_000781370.1.101293 WP_000781370.1.10131 WP_000781370.1.101313 WP_000781370.1.101359 WP_000781370.1.10138 WP_000781370.1.101387 WP_000781370.1.101399 WP_000781370.1.101418 WP_000781370.1.101423 WP_000781370.1.101429 WP_000781370.1.101430 WP_000781370.1.101436 WP_000781370.1.101439 WP_000781370.1.101445 WP_000781370.1.101468 WP_000781370.1.101486 WP_000781370.1.101518 WP_000781370.1.10154 WP_000781370.1.101583 WP_000781370.1.101594 WP_000781370.1.101630 WP_000781370.1.101651 WP_000781370.1.101653 WP_000781370.1.101654 WP_000781370.1.101686 WP_000781370.1.101693 WP_000781370.1.101694 WP_000781370.1.101700 WP_000781370.1.101727 WP_000781370.1.10173 WP_000781370.1.101737 WP_000781370.1.101747 WP_000781370.1.101769 WP_000781370.1.101777 WP_000781370.1.101786 WP_000781370.1.10181 WP_000781370.1.101822 WP_000781370.1.10184 WP_000781370.1.101840 WP_000781370.1.101845 WP_000781370.1.101855 WP_000781370.1.101865 WP_000781370.1.10187 WP_000781370.1.10188 WP_000781370.1.101887 WP_000781370.1.101889 WP_000781370.1.10190 WP_000781370.1.101900 WP_000781370.1.101908 WP_000781370.1.101913 WP_000781370.1.101926 WP_000781370.1.101932 WP_000781370.1.101935 WP_000781370.1.101937 WP_000781370.1.101940 WP_000781370.1.101942 WP_000781370.1.101947 WP_000781370.1.101952 WP_000781370.1.101962 WP_000781370.1.101964 WP_000781370.1.101969 WP_000781370.1.101977 WP_000781370.1.101984 WP_000781370.1.101987 WP_000781370.1.102021 WP_000781370.1.102036 WP_000781370.1.102069 WP_000781370.1.102076 WP_000781370.1.102093 WP_000781370.1.102104 WP_000781370.1.102106 WP_000781370.1.102122 WP_000781370.1.102144 WP_000781370.1.10222 WP_000781370.1.10233 WP_000781370.1.10235 WP_000781370.1.10252 WP_000781370.1.10304 WP_000781370.1.10326 WP_000781370.1.10329 WP_000781370.1.10348 WP_000781370.1.10352 WP_000781370.1.10379 WP_000781370.1.1040 WP_000781370.1.10417 WP_000781370.1.10461 WP_000781370.1.10491 WP_000781370.1.10492 WP_000781370.1.10496 WP_000781370.1.10508 WP_000781370.1.10525 WP_000781370.1.10538 WP_000781370.1.10569 WP_000781370.1.10573 WP_000781370.1.10576 WP_000781370.1.10579 WP_000781370.1.1058 WP_000781370.1.10605 WP_000781370.1.10607 WP_000781370.1.10628 WP_000781370.1.10651 WP_000781370.1.10673 WP_000781370.1.10697 WP_000781370.1.10705 WP_000781370.1.1071 WP_000781370.1.10715 WP_000781370.1.10729 WP_000781370.1.1073 WP_000781370.1.1074 WP_000781370.1.10744 WP_000781370.1.10748 WP_000781370.1.10763 WP_000781370.1.10771 WP_000781370.1.10786 WP_000781370.1.10798 WP_000781370.1.10809 WP_000781370.1.10814 WP_000781370.1.10833 WP_000781370.1.10842 WP_000781370.1.10849 WP_000781370.1.10862 WP_000781370.1.10869 WP_000781370.1.10922 WP_000781370.1.10940 WP_000781370.1.10988 WP_000781370.1.10989 WP_000781370.1.10994 WP_000781370.1.10995 WP_000781370.1.11006 WP_000781370.1.11032 WP_000781370.1.11047 WP_000781370.1.11057 WP_000781370.1.11068 WP_000781370.1.11071 WP_000781370.1.11091 WP_000781370.1.11113 WP_000781370.1.11118 WP_000781370.1.11121 WP_000781370.1.1113 WP_000781370.1.11133 WP_000781370.1.112 WP_000781370.1.11217 WP_000781370.1.1122 WP_000781370.1.11241 WP_000781370.1.11250 WP_000781370.1.11251 WP_000781370.1.11265 WP_000781370.1.11272 WP_000781370.1.11285 WP_000781370.1.11296 WP_000781370.1.11315 WP_000781370.1.11323 WP_000781370.1.11399 WP_000781370.1.11408 WP_000781370.1.11411 WP_000781370.1.11418 WP_000781370.1.11436 WP_000781370.1.11437 WP_000781370.1.11440 WP_000781370.1.11452 WP_000781370.1.11467 WP_000781370.1.11499 WP_000781370.1.11519 WP_000781370.1.11524 WP_000781370.1.11531 WP_000781370.1.11575 WP_000781370.1.11578 WP_000781370.1.11595 WP_000781370.1.11607 WP_000781370.1.11608 WP_000781370.1.11612 WP_000781370.1.11616 WP_000781370.1.11645 WP_000781370.1.11673 WP_000781370.1.1168 WP_000781370.1.11699 WP_000781370.1.11748 WP_000781370.1.11759 WP_000781370.1.1176 WP_000781370.1.11762 WP_000781370.1.11803 WP_000781370.1.11844 WP_000781370.1.1186 WP_000781370.1.11948 WP_000781370.1.11949 WP_000781370.1.11955 WP_000781370.1.11956 WP_000781370.1.1196 WP_000781370.1.11981 WP_000781370.1.11982 WP_000781370.1.12000 WP_000781370.1.12009 WP_000781370.1.12010 WP_000781370.1.12030 WP_000781370.1.12036 WP_000781370.1.12050 WP_000781370.1.12051 WP_000781370.1.12060 WP_000781370.1.12076 WP_000781370.1.12088 WP_000781370.1.12095 WP_000781370.1.12111 WP_000781370.1.12112 WP_000781370.1.12115 WP_000781370.1.1212 WP_000781370.1.12151 WP_000781370.1.12157 WP_000781370.1.1218 WP_000781370.1.12204 WP_000781370.1.12230 WP_000781370.1.12268 WP_000781370.1.12279 WP_000781370.1.12292 WP_000781370.1.12295 WP_000781370.1.12319 WP_000781370.1.12320 WP_000781370.1.12342 WP_000781370.1.12344 WP_000781370.1.12352 WP_000781370.1.12415 WP_000781370.1.1242 WP_000781370.1.12426 WP_000781370.1.12458 WP_000781370.1.12459 WP_000781370.1.12478 WP_000781370.1.12542 WP_000781370.1.12558 WP_000781370.1.12566 WP_000781370.1.12574 WP_000781370.1.12582 WP_000781370.1.12594 WP_000781370.1.12623 WP_000781370.1.12645 WP_000781370.1.12646 WP_000781370.1.12675 WP_000781370.1.12679 WP_000781370.1.12680 WP_000781370.1.12693 WP_000781370.1.12697 WP_000781370.1.127 WP_000781370.1.12709 WP_000781370.1.12717 WP_000781370.1.12743 WP_000781370.1.12749 WP_000781370.1.1275 WP_000781370.1.12756 WP_000781370.1.12761 WP_000781370.1.12762 WP_000781370.1.12763 WP_000781370.1.12775 WP_000781370.1.1278 WP_000781370.1.12781 WP_000781370.1.1280 WP_000781370.1.12826 WP_000781370.1.12830 WP_000781370.1.12831 WP_000781370.1.12876 WP_000781370.1.12911 WP_000781370.1.12914 WP_000781370.1.12915 WP_000781370.1.12917 WP_000781370.1.1295 WP_000781370.1.12956 WP_000781370.1.12976 WP_000781370.1.12979 WP_000781370.1.12987 WP_000781370.1.12991 WP_000781370.1.13002 WP_000781370.1.13015 WP_000781370.1.13031 WP_000781370.1.13074 WP_000781370.1.1308 WP_000781370.1.13117 WP_000781370.1.1312 WP_000781370.1.13136 WP_000781370.1.1314 WP_000781370.1.13144 WP_000781370.1.1315 WP_000781370.1.13176 WP_000781370.1.13181 WP_000781370.1.13205 WP_000781370.1.13222 WP_000781370.1.1323 WP_000781370.1.13239 WP_000781370.1.13252 WP_000781370.1.13258 WP_000781370.1.13271 WP_000781370.1.13272 WP_000781370.1.13278 WP_000781370.1.13281 WP_000781370.1.13290 WP_000781370.1.13295 WP_000781370.1.13301 WP_000781370.1.13333 WP_000781370.1.13346 WP_000781370.1.1335 WP_000781370.1.13383 WP_000781370.1.13393 WP_000781370.1.13409 WP_000781370.1.13411 WP_000781370.1.1343 WP_000781370.1.13437 WP_000781370.1.1345 WP_000781370.1.13451 WP_000781370.1.13469 WP_000781370.1.13473 WP_000781370.1.13492 WP_000781370.1.13495 WP_000781370.1.13525 WP_000781370.1.13566 WP_000781370.1.13585 WP_000781370.1.13589 WP_000781370.1.13600 WP_000781370.1.13601 WP_000781370.1.13608 WP_000781370.1.13618 WP_000781370.1.13624 WP_000781370.1.13626 WP_000781370.1.13644 WP_000781370.1.13662 WP_000781370.1.13664 WP_000781370.1.13672 WP_000781370.1.13740 WP_000781370.1.13778 WP_000781370.1.13791 WP_000781370.1.13798 WP_000781370.1.13824 WP_000781370.1.13867 WP_000781370.1.13877 WP_000781370.1.13891 WP_000781370.1.13924 WP_000781370.1.13934 WP_000781370.1.13944 WP_000781370.1.13949 WP_000781370.1.13974 WP_000781370.1.13979 WP_000781370.1.13981 WP_000781370.1.14023 WP_000781370.1.14030 WP_000781370.1.14042 WP_000781370.1.14058 WP_000781370.1.14062 WP_000781370.1.14070 WP_000781370.1.14094 WP_000781370.1.14127 WP_000781370.1.14129 WP_000781370.1.14144 WP_000781370.1.14154 WP_000781370.1.14164 WP_000781370.1.1419 WP_000781370.1.14199 WP_000781370.1.142 WP_000781370.1.14245 WP_000781370.1.14253 WP_000781370.1.14277 WP_000781370.1.14292 WP_000781370.1.14299 WP_000781370.1.14304 WP_000781370.1.14322 WP_000781370.1.14331 WP_000781370.1.14346 WP_000781370.1.14371 WP_000781370.1.1438 WP_000781370.1.14389 WP_000781370.1.1439 WP_000781370.1.14398 WP_000781370.1.14417 WP_000781370.1.14432 WP_000781370.1.14445 WP_000781370.1.14451 WP_000781370.1.14468 WP_000781370.1.14499 WP_000781370.1.14506 WP_000781370.1.14508 WP_000781370.1.14509 WP_000781370.1.14529 WP_000781370.1.14536 WP_000781370.1.14538 WP_000781370.1.14581 WP_000781370.1.14582 WP_000781370.1.14600 WP_000781370.1.14601 WP_000781370.1.14605 WP_000781370.1.14607 WP_000781370.1.1461 WP_000781370.1.14616 WP_000781370.1.14648 WP_000781370.1.14672 WP_000781370.1.14678 WP_000781370.1.14693 WP_000781370.1.1470 WP_000781370.1.14711 WP_000781370.1.14712 WP_000781370.1.14746 WP_000781370.1.14749 WP_000781370.1.14811 WP_000781370.1.14833 WP_000781370.1.1486 WP_000781370.1.14861 WP_000781370.1.14871 WP_000781370.1.14879 WP_000781370.1.14914 WP_000781370.1.14934 WP_000781370.1.14935 WP_000781370.1.14946 WP_000781370.1.14956 WP_000781370.1.14958 WP_000781370.1.14963 WP_000781370.1.14965 WP_000781370.1.14977 WP_000781370.1.14992 WP_000781370.1.14993 WP_000781370.1.15007 WP_000781370.1.15020 WP_000781370.1.15041 WP_000781370.1.15068 WP_000781370.1.1508 WP_000781370.1.15087 WP_000781370.1.15090 WP_000781370.1.1510 WP_000781370.1.15117 WP_000781370.1.1512 WP_000781370.1.15121 WP_000781370.1.15138 WP_000781370.1.15148 WP_000781370.1.15177 WP_000781370.1.15191 WP_000781370.1.15193 WP_000781370.1.15221 WP_000781370.1.1524 WP_000781370.1.15245 WP_000781370.1.15252 WP_000781370.1.15259 WP_000781370.1.15270 WP_000781370.1.15274 WP_000781370.1.15277 WP_000781370.1.15282 WP_000781370.1.15287 WP_000781370.1.15290 WP_000781370.1.153 WP_000781370.1.15300 WP_000781370.1.15304 WP_000781370.1.15332 WP_000781370.1.15335 WP_000781370.1.15347 WP_000781370.1.15377 WP_000781370.1.15416 WP_000781370.1.15420 WP_000781370.1.1543 WP_000781370.1.15444 WP_000781370.1.15464 WP_000781370.1.15469 WP_000781370.1.15496 WP_000781370.1.1550 WP_000781370.1.15521 WP_000781370.1.15528 WP_000781370.1.15538 WP_000781370.1.15565 WP_000781370.1.15576 WP_000781370.1.15583 WP_000781370.1.15593 WP_000781370.1.15600 WP_000781370.1.1561 WP_000781370.1.15620 WP_000781370.1.15624 WP_000781370.1.15645 WP_000781370.1.15654 WP_000781370.1.15707 WP_000781370.1.15747 WP_000781370.1.15752 WP_000781370.1.15762 WP_000781370.1.15767 WP_000781370.1.15768 WP_000781370.1.15771 WP_000781370.1.15791 WP_000781370.1.1580 WP_000781370.1.15809 WP_000781370.1.1582 WP_000781370.1.15855 WP_000781370.1.15857 WP_000781370.1.15863 WP_000781370.1.1588 WP_000781370.1.15894 WP_000781370.1.15906 WP_000781370.1.15916 WP_000781370.1.15945 WP_000781370.1.15949 WP_000781370.1.15951 WP_000781370.1.15983 WP_000781370.1.15984 WP_000781370.1.15990 WP_000781370.1.16010 WP_000781370.1.16014 WP_000781370.1.16015 WP_000781370.1.16034 WP_000781370.1.1604 WP_000781370.1.16042 WP_000781370.1.16067 WP_000781370.1.16086 WP_000781370.1.16087 WP_000781370.1.1609 WP_000781370.1.16102 WP_000781370.1.16111 WP_000781370.1.16117 WP_000781370.1.16131 WP_000781370.1.16154 WP_000781370.1.16171 WP_000781370.1.16175 WP_000781370.1.16179 WP_000781370.1.16183 WP_000781370.1.16188 WP_000781370.1.16194 WP_000781370.1.1621 WP_000781370.1.1622 WP_000781370.1.16294 WP_000781370.1.163 WP_000781370.1.16303 WP_000781370.1.16322 WP_000781370.1.1634 WP_000781370.1.16387 WP_000781370.1.16388 WP_000781370.1.16396 WP_000781370.1.1640 WP_000781370.1.16435 WP_000781370.1.16482 WP_000781370.1.16500 WP_000781370.1.16517 WP_000781370.1.16532 WP_000781370.1.16539 WP_000781370.1.16541 WP_000781370.1.1655 WP_000781370.1.16577 WP_000781370.1.16592 WP_000781370.1.16604 WP_000781370.1.16608 WP_000781370.1.16612 WP_000781370.1.16640 WP_000781370.1.16648 WP_000781370.1.16667 WP_000781370.1.16669 WP_000781370.1.16682 WP_000781370.1.16685 WP_000781370.1.16700 WP_000781370.1.16705 WP_000781370.1.16715 WP_000781370.1.16721 WP_000781370.1.1673 WP_000781370.1.16745 WP_000781370.1.16752 WP_000781370.1.16766 WP_000781370.1.16780 WP_000781370.1.16798 WP_000781370.1.16799 WP_000781370.1.16805 WP_000781370.1.16807 WP_000781370.1.16818 WP_000781370.1.16843 WP_000781370.1.16861 WP_000781370.1.16862 WP_000781370.1.16894 WP_000781370.1.16927 WP_000781370.1.16970 WP_000781370.1.16979 WP_000781370.1.16992 WP_000781370.1.17014 WP_000781370.1.17017 WP_000781370.1.17018 WP_000781370.1.17042 WP_000781370.1.17061 WP_000781370.1.17084 WP_000781370.1.17085 WP_000781370.1.17087 WP_000781370.1.17089 WP_000781370.1.1710 WP_000781370.1.17102 WP_000781370.1.17109 WP_000781370.1.17111 WP_000781370.1.17114 WP_000781370.1.17119 WP_000781370.1.17123 WP_000781370.1.17150 WP_000781370.1.17153 WP_000781370.1.17170 WP_000781370.1.17172 WP_000781370.1.17182 WP_000781370.1.17205 WP_000781370.1.17206 WP_000781370.1.17216 WP_000781370.1.17230 WP_000781370.1.17241 WP_000781370.1.17242 WP_000781370.1.1726 WP_000781370.1.17267 WP_000781370.1.17290 WP_000781370.1.17297 WP_000781370.1.17300 WP_000781370.1.17301 WP_000781370.1.17325 WP_000781370.1.17333 WP_000781370.1.17356 WP_000781370.1.17360 WP_000781370.1.17373 WP_000781370.1.17387 WP_000781370.1.17389 WP_000781370.1.17392 WP_000781370.1.17403 WP_000781370.1.17410 WP_000781370.1.17417 WP_000781370.1.17432 WP_000781370.1.17441 WP_000781370.1.17461 WP_000781370.1.17464 WP_000781370.1.17496 WP_000781370.1.17534 WP_000781370.1.1754 WP_000781370.1.1755 WP_000781370.1.17550 WP_000781370.1.17568 WP_000781370.1.17570 WP_000781370.1.17577 WP_000781370.1.17584 WP_000781370.1.17595 WP_000781370.1.17623 WP_000781370.1.17637 WP_000781370.1.1766 WP_000781370.1.1769 WP_000781370.1.17701 WP_000781370.1.1772 WP_000781370.1.17734 WP_000781370.1.17757 WP_000781370.1.17765 WP_000781370.1.17766 WP_000781370.1.17769 WP_000781370.1.1778 WP_000781370.1.17802 WP_000781370.1.17829 WP_000781370.1.17831 WP_000781370.1.17836 WP_000781370.1.17849 WP_000781370.1.17889 WP_000781370.1.17920 WP_000781370.1.17925 WP_000781370.1.17937 WP_000781370.1.17952 WP_000781370.1.17961 WP_000781370.1.17963 WP_000781370.1.17984 WP_000781370.1.18000 WP_000781370.1.18006 WP_000781370.1.1802 WP_000781370.1.18024 WP_000781370.1.18050 WP_000781370.1.18064 WP_000781370.1.18094 WP_000781370.1.18118 WP_000781370.1.18121 WP_000781370.1.18133 WP_000781370.1.18164 WP_000781370.1.18175 WP_000781370.1.1821 WP_000781370.1.18225 WP_000781370.1.18226 WP_000781370.1.18229 WP_000781370.1.18311 WP_000781370.1.18316 WP_000781370.1.18329 WP_000781370.1.18337 WP_000781370.1.18338 WP_000781370.1.18348 WP_000781370.1.18354 WP_000781370.1.18381 WP_000781370.1.18383 WP_000781370.1.18394 WP_000781370.1.18402 WP_000781370.1.18410 WP_000781370.1.18420 WP_000781370.1.18436 WP_000781370.1.18438 WP_000781370.1.1844 WP_000781370.1.18458 WP_000781370.1.18461 WP_000781370.1.18472 WP_000781370.1.18482 WP_000781370.1.18511 WP_000781370.1.18519 WP_000781370.1.18530 WP_000781370.1.18556 WP_000781370.1.18581 WP_000781370.1.18583 WP_000781370.1.18588 WP_000781370.1.1861 WP_000781370.1.18617 WP_000781370.1.1862 WP_000781370.1.18628 WP_000781370.1.18649 WP_000781370.1.18651 WP_000781370.1.18655 WP_000781370.1.1866 WP_000781370.1.18666 WP_000781370.1.1867 WP_000781370.1.18675 WP_000781370.1.18699 WP_000781370.1.18714 WP_000781370.1.18725 WP_000781370.1.18726 WP_000781370.1.1873 WP_000781370.1.18734 WP_000781370.1.18794 WP_000781370.1.188 WP_000781370.1.18801 WP_000781370.1.18802 WP_000781370.1.18806 WP_000781370.1.18828 WP_000781370.1.18843 WP_000781370.1.18858 WP_000781370.1.18874 WP_000781370.1.18876 WP_000781370.1.18899 WP_000781370.1.18908 WP_000781370.1.18923 WP_000781370.1.18934 WP_000781370.1.18936 WP_000781370.1.1896 WP_000781370.1.18962 WP_000781370.1.18966 WP_000781370.1.18983 WP_000781370.1.1903 WP_000781370.1.19036 WP_000781370.1.1906 WP_000781370.1.19075 WP_000781370.1.1909 WP_000781370.1.19090 WP_000781370.1.19100 WP_000781370.1.19113 WP_000781370.1.19114 WP_000781370.1.19122 WP_000781370.1.19129 WP_000781370.1.19135 WP_000781370.1.19146 WP_000781370.1.19147 WP_000781370.1.1915 WP_000781370.1.19150 WP_000781370.1.19153 WP_000781370.1.19171 WP_000781370.1.19194 WP_000781370.1.19205 WP_000781370.1.19206 WP_000781370.1.19245 WP_000781370.1.1925 WP_000781370.1.19276 WP_000781370.1.19277 WP_000781370.1.19297 WP_000781370.1.193 WP_000781370.1.19312 WP_000781370.1.19313 WP_000781370.1.19314 WP_000781370.1.19315 WP_000781370.1.19332 WP_000781370.1.19338 WP_000781370.1.19347 WP_000781370.1.19361 WP_000781370.1.19374 WP_000781370.1.19379 WP_000781370.1.19389 WP_000781370.1.19397 WP_000781370.1.19424 WP_000781370.1.19441 WP_000781370.1.19448 WP_000781370.1.19478 WP_000781370.1.19487 WP_000781370.1.19492 WP_000781370.1.19494 WP_000781370.1.1952 WP_000781370.1.19534 WP_000781370.1.19544 WP_000781370.1.19545 WP_000781370.1.19547 WP_000781370.1.19557 WP_000781370.1.19581 WP_000781370.1.19583 WP_000781370.1.19593 WP_000781370.1.1960 WP_000781370.1.19602 WP_000781370.1.1963 WP_000781370.1.19644 WP_000781370.1.19649 WP_000781370.1.19651 WP_000781370.1.19654 WP_000781370.1.19655 WP_000781370.1.19661 WP_000781370.1.19684 WP_000781370.1.19691 WP_000781370.1.19758 WP_000781370.1.19760 WP_000781370.1.19761 WP_000781370.1.19778 WP_000781370.1.19795 WP_000781370.1.1982 WP_000781370.1.19830 WP_000781370.1.19838 WP_000781370.1.19845 WP_000781370.1.19861 WP_000781370.1.1987 WP_000781370.1.19873 WP_000781370.1.19878 WP_000781370.1.19889 WP_000781370.1.19940 WP_000781370.1.19945 WP_000781370.1.19957 WP_000781370.1.19972 WP_000781370.1.20025 WP_000781370.1.20096 WP_000781370.1.20114 WP_000781370.1.20115 WP_000781370.1.20129 WP_000781370.1.20133 WP_000781370.1.2015 WP_000781370.1.20157 WP_000781370.1.20159 WP_000781370.1.20164 WP_000781370.1.20166 WP_000781370.1.20170 WP_000781370.1.20178 WP_000781370.1.20183 WP_000781370.1.20192 WP_000781370.1.20215 WP_000781370.1.2022 WP_000781370.1.20230 WP_000781370.1.20238 WP_000781370.1.20251 WP_000781370.1.2027 WP_000781370.1.20289 WP_000781370.1.20290 WP_000781370.1.20318 WP_000781370.1.20325 WP_000781370.1.20331 WP_000781370.1.20334 WP_000781370.1.20370 WP_000781370.1.20388 WP_000781370.1.20442 WP_000781370.1.20445 WP_000781370.1.20452 WP_000781370.1.20483 WP_000781370.1.20493 WP_000781370.1.20515 WP_000781370.1.20519 WP_000781370.1.20536 WP_000781370.1.20575 WP_000781370.1.20596 WP_000781370.1.2063 WP_000781370.1.20630 WP_000781370.1.20636 WP_000781370.1.20638 WP_000781370.1.20640 WP_000781370.1.20662 WP_000781370.1.20668 WP_000781370.1.20691 WP_000781370.1.20709 WP_000781370.1.20724 WP_000781370.1.20730 WP_000781370.1.20737 WP_000781370.1.20741 WP_000781370.1.2075 WP_000781370.1.20761 WP_000781370.1.20765 WP_000781370.1.20784 WP_000781370.1.20785 WP_000781370.1.20803 WP_000781370.1.20813 WP_000781370.1.20818 WP_000781370.1.20824 WP_000781370.1.20831 WP_000781370.1.20841 WP_000781370.1.20848 WP_000781370.1.20863 WP_000781370.1.20907 WP_000781370.1.2092 WP_000781370.1.2093 WP_000781370.1.20933 WP_000781370.1.2094 WP_000781370.1.20943 WP_000781370.1.20958 WP_000781370.1.20962 WP_000781370.1.20982 WP_000781370.1.2100 WP_000781370.1.21017 WP_000781370.1.21020 WP_000781370.1.21022 WP_000781370.1.21024 WP_000781370.1.21033 WP_000781370.1.21041 WP_000781370.1.21057 WP_000781370.1.21059 WP_000781370.1.21104 WP_000781370.1.21122 WP_000781370.1.21129 WP_000781370.1.2113 WP_000781370.1.21131 WP_000781370.1.21137 WP_000781370.1.21152 WP_000781370.1.21171 WP_000781370.1.21197 WP_000781370.1.21248 WP_000781370.1.21255 WP_000781370.1.21266 WP_000781370.1.21277 WP_000781370.1.21305 WP_000781370.1.21320 WP_000781370.1.21336 WP_000781370.1.21378 WP_000781370.1.21441 WP_000781370.1.21450 WP_000781370.1.21455 WP_000781370.1.21470 WP_000781370.1.21519 WP_000781370.1.21526 WP_000781370.1.21537 WP_000781370.1.2156 WP_000781370.1.21573 WP_000781370.1.21578 WP_000781370.1.21596 WP_000781370.1.21614 WP_000781370.1.21628 WP_000781370.1.21634 WP_000781370.1.21637 WP_000781370.1.2164 WP_000781370.1.21652 WP_000781370.1.21656 WP_000781370.1.21667 WP_000781370.1.21673 WP_000781370.1.21696 WP_000781370.1.21714 WP_000781370.1.21727 WP_000781370.1.21729 WP_000781370.1.21732 WP_000781370.1.21733 WP_000781370.1.21756 WP_000781370.1.21758 WP_000781370.1.21762 WP_000781370.1.21771 WP_000781370.1.21811 WP_000781370.1.21812 WP_000781370.1.21823 WP_000781370.1.21887 WP_000781370.1.21895 WP_000781370.1.21899 WP_000781370.1.21915 WP_000781370.1.21945 WP_000781370.1.21948 WP_000781370.1.2198 WP_000781370.1.22021 WP_000781370.1.22042 WP_000781370.1.22060 WP_000781370.1.22088 WP_000781370.1.22113 WP_000781370.1.22138 WP_000781370.1.22161 WP_000781370.1.22182 WP_000781370.1.22189 WP_000781370.1.22195 WP_000781370.1.22203 WP_000781370.1.22204 WP_000781370.1.22268 WP_000781370.1.22272 WP_000781370.1.22280 WP_000781370.1.22291 WP_000781370.1.22293 WP_000781370.1.22295 WP_000781370.1.22314 WP_000781370.1.2232 WP_000781370.1.22325 WP_000781370.1.22350 WP_000781370.1.22359 WP_000781370.1.22363 WP_000781370.1.2242 WP_000781370.1.22431 WP_000781370.1.2245 WP_000781370.1.22450 WP_000781370.1.22464 WP_000781370.1.22470 WP_000781370.1.22494 WP_000781370.1.22501 WP_000781370.1.22508 WP_000781370.1.22544 WP_000781370.1.22549 WP_000781370.1.22571 WP_000781370.1.22572 WP_000781370.1.22576 WP_000781370.1.22599 WP_000781370.1.22602 WP_000781370.1.22631 WP_000781370.1.22632 WP_000781370.1.22641 WP_000781370.1.22649 WP_000781370.1.22662 WP_000781370.1.22667 WP_000781370.1.22669 WP_000781370.1.22685 WP_000781370.1.22690 WP_000781370.1.22756 WP_000781370.1.22757 WP_000781370.1.22759 WP_000781370.1.22765 WP_000781370.1.22777 WP_000781370.1.22783 WP_000781370.1.22809 WP_000781370.1.22814 WP_000781370.1.22824 WP_000781370.1.22827 WP_000781370.1.22830 WP_000781370.1.22846 WP_000781370.1.22868 WP_000781370.1.22875 WP_000781370.1.22878 WP_000781370.1.22885 WP_000781370.1.22908 WP_000781370.1.22917 WP_000781370.1.22939 WP_000781370.1.22961 WP_000781370.1.22988 WP_000781370.1.22990 WP_000781370.1.22993 WP_000781370.1.2300 WP_000781370.1.23005 WP_000781370.1.23021 WP_000781370.1.23026 WP_000781370.1.23035 WP_000781370.1.23042 WP_000781370.1.23044 WP_000781370.1.23045 WP_000781370.1.23057 WP_000781370.1.23062 WP_000781370.1.23078 WP_000781370.1.23081 WP_000781370.1.23090 WP_000781370.1.23092 WP_000781370.1.23105 WP_000781370.1.23109 WP_000781370.1.23120 WP_000781370.1.23135 WP_000781370.1.2322 WP_000781370.1.23230 WP_000781370.1.2325 WP_000781370.1.23257 WP_000781370.1.23270 WP_000781370.1.23282 WP_000781370.1.23285 WP_000781370.1.23290 WP_000781370.1.23293 WP_000781370.1.23330 WP_000781370.1.23351 WP_000781370.1.23352 WP_000781370.1.23376 WP_000781370.1.23383 WP_000781370.1.23386 WP_000781370.1.23388 WP_000781370.1.23393 WP_000781370.1.23435 WP_000781370.1.23443 WP_000781370.1.23456 WP_000781370.1.23486 WP_000781370.1.23487 WP_000781370.1.23511 WP_000781370.1.23520 WP_000781370.1.23522 WP_000781370.1.23527 WP_000781370.1.2353 WP_000781370.1.23549 WP_000781370.1.23554 WP_000781370.1.23561 WP_000781370.1.23563 WP_000781370.1.23575 WP_000781370.1.23584 WP_000781370.1.2362 WP_000781370.1.23625 WP_000781370.1.23640 WP_000781370.1.23660 WP_000781370.1.23676 WP_000781370.1.23686 WP_000781370.1.23693 WP_000781370.1.23700 WP_000781370.1.23711 WP_000781370.1.23724 WP_000781370.1.23729 WP_000781370.1.23741 WP_000781370.1.23752 WP_000781370.1.23754 WP_000781370.1.23765 WP_000781370.1.23795 WP_000781370.1.23804 WP_000781370.1.23812 WP_000781370.1.23840 WP_000781370.1.23869 WP_000781370.1.23881 WP_000781370.1.23886 WP_000781370.1.23890 WP_000781370.1.23898 WP_000781370.1.23914 WP_000781370.1.23915 WP_000781370.1.23931 WP_000781370.1.23945 WP_000781370.1.23950 WP_000781370.1.23953 WP_000781370.1.23962 WP_000781370.1.23970 WP_000781370.1.23971 WP_000781370.1.23985 WP_000781370.1.24 WP_000781370.1.24004 WP_000781370.1.24024 WP_000781370.1.24038 WP_000781370.1.24045 WP_000781370.1.24051 WP_000781370.1.24058 WP_000781370.1.24068 WP_000781370.1.24088 WP_000781370.1.24089 WP_000781370.1.24120 WP_000781370.1.24122 WP_000781370.1.24124 WP_000781370.1.24127 WP_000781370.1.2413 WP_000781370.1.24136 WP_000781370.1.24169 WP_000781370.1.24177 WP_000781370.1.2418 WP_000781370.1.24194 WP_000781370.1.24233 WP_000781370.1.24278 WP_000781370.1.2428 WP_000781370.1.24290 WP_000781370.1.2430 WP_000781370.1.24304 WP_000781370.1.24316 WP_000781370.1.24362 WP_000781370.1.2437 WP_000781370.1.24374 WP_000781370.1.24381 WP_000781370.1.24383 WP_000781370.1.24460 WP_000781370.1.24473 WP_000781370.1.24483 WP_000781370.1.24485 WP_000781370.1.2449 WP_000781370.1.24499 WP_000781370.1.24523 WP_000781370.1.24524 WP_000781370.1.24533 WP_000781370.1.24536 WP_000781370.1.2456 WP_000781370.1.24560 WP_000781370.1.24570 WP_000781370.1.24575 WP_000781370.1.24577 WP_000781370.1.24583 WP_000781370.1.24592 WP_000781370.1.24616 WP_000781370.1.24634 WP_000781370.1.24641 WP_000781370.1.24642 WP_000781370.1.24646 WP_000781370.1.24650 WP_000781370.1.2469 WP_000781370.1.24693 WP_000781370.1.24695 WP_000781370.1.24703 WP_000781370.1.24752 WP_000781370.1.24758 WP_000781370.1.24763 WP_000781370.1.24773 WP_000781370.1.24783 WP_000781370.1.2479 WP_000781370.1.24791 WP_000781370.1.24797 WP_000781370.1.24799 WP_000781370.1.24808 WP_000781370.1.24849 WP_000781370.1.24854 WP_000781370.1.24876 WP_000781370.1.24899 WP_000781370.1.24902 WP_000781370.1.24906 WP_000781370.1.24926 WP_000781370.1.24929 WP_000781370.1.24939 WP_000781370.1.24946 WP_000781370.1.24960 WP_000781370.1.24979 WP_000781370.1.24981 WP_000781370.1.24982 WP_000781370.1.24984 WP_000781370.1.25019 WP_000781370.1.2502 WP_000781370.1.25021 WP_000781370.1.25039 WP_000781370.1.2504 WP_000781370.1.25042 WP_000781370.1.25050 WP_000781370.1.25060 WP_000781370.1.25079 WP_000781370.1.25085 WP_000781370.1.25086 WP_000781370.1.25087 WP_000781370.1.2512 WP_000781370.1.25126 WP_000781370.1.25141 WP_000781370.1.25174 WP_000781370.1.25193 WP_000781370.1.25203 WP_000781370.1.25204 WP_000781370.1.25248 WP_000781370.1.25270 WP_000781370.1.25272 WP_000781370.1.25289 WP_000781370.1.2531 WP_000781370.1.25312 WP_000781370.1.25324 WP_000781370.1.25346 WP_000781370.1.2537 WP_000781370.1.25378 WP_000781370.1.25380 WP_000781370.1.254 WP_000781370.1.2540 WP_000781370.1.25403 WP_000781370.1.25414 WP_000781370.1.25420 WP_000781370.1.2543 WP_000781370.1.25446 WP_000781370.1.25480 WP_000781370.1.255 WP_000781370.1.25517 WP_000781370.1.25525 WP_000781370.1.25548 WP_000781370.1.2558 WP_000781370.1.25592 WP_000781370.1.25598 WP_000781370.1.25602 WP_000781370.1.25612 WP_000781370.1.25613 WP_000781370.1.25631 WP_000781370.1.25652 WP_000781370.1.2567 WP_000781370.1.25680 WP_000781370.1.25681 WP_000781370.1.25701 WP_000781370.1.25712 WP_000781370.1.25713 WP_000781370.1.25717 WP_000781370.1.25718 WP_000781370.1.25724 WP_000781370.1.25726 WP_000781370.1.25750 WP_000781370.1.25753 WP_000781370.1.25755 WP_000781370.1.25855 WP_000781370.1.25869 WP_000781370.1.25873 WP_000781370.1.2588 WP_000781370.1.25886 WP_000781370.1.2589 WP_000781370.1.25890 WP_000781370.1.25895 WP_000781370.1.25915 WP_000781370.1.25945 WP_000781370.1.2597 WP_000781370.1.25996 WP_000781370.1.26040 WP_000781370.1.26048 WP_000781370.1.26055 WP_000781370.1.2606 WP_000781370.1.26061 WP_000781370.1.26076 WP_000781370.1.26092 WP_000781370.1.26100 WP_000781370.1.2612 WP_000781370.1.26125 WP_000781370.1.26130 WP_000781370.1.26135 WP_000781370.1.26150 WP_000781370.1.26175 WP_000781370.1.26186 WP_000781370.1.26189 WP_000781370.1.26191 WP_000781370.1.26196 WP_000781370.1.26259 WP_000781370.1.26262 WP_000781370.1.26264 WP_000781370.1.26270 WP_000781370.1.26284 WP_000781370.1.26304 WP_000781370.1.26325 WP_000781370.1.26331 WP_000781370.1.2637 WP_000781370.1.26391 WP_000781370.1.26398 WP_000781370.1.26401 WP_000781370.1.26403 WP_000781370.1.2642 WP_000781370.1.26467 WP_000781370.1.26479 WP_000781370.1.26480 WP_000781370.1.26517 WP_000781370.1.26569 WP_000781370.1.26570 WP_000781370.1.26574 WP_000781370.1.26575 WP_000781370.1.26579 WP_000781370.1.26588 WP_000781370.1.26598 WP_000781370.1.26609 WP_000781370.1.26613 WP_000781370.1.26627 WP_000781370.1.26644 WP_000781370.1.2665 WP_000781370.1.26658 WP_000781370.1.26659 WP_000781370.1.26660 WP_000781370.1.26683 WP_000781370.1.26688 WP_000781370.1.26716 WP_000781370.1.26720 WP_000781370.1.26736 WP_000781370.1.26766 WP_000781370.1.26782 WP_000781370.1.26837 WP_000781370.1.26839 WP_000781370.1.26861 WP_000781370.1.2688 WP_000781370.1.26912 WP_000781370.1.26932 WP_000781370.1.26941 WP_000781370.1.26943 WP_000781370.1.2695 WP_000781370.1.26950 WP_000781370.1.26987 WP_000781370.1.26995 WP_000781370.1.2700 WP_000781370.1.27019 WP_000781370.1.27043 WP_000781370.1.27057 WP_000781370.1.27060 WP_000781370.1.27091 WP_000781370.1.27098 WP_000781370.1.27101 WP_000781370.1.27105 WP_000781370.1.2712 WP_000781370.1.27134 WP_000781370.1.27141 WP_000781370.1.27148 WP_000781370.1.27175 WP_000781370.1.27188 WP_000781370.1.27214 WP_000781370.1.27234 WP_000781370.1.27260 WP_000781370.1.27280 WP_000781370.1.27283 WP_000781370.1.27287 WP_000781370.1.27292 WP_000781370.1.2731 WP_000781370.1.27310 WP_000781370.1.27313 WP_000781370.1.27330 WP_000781370.1.27367 WP_000781370.1.27373 WP_000781370.1.27396 WP_000781370.1.27401 WP_000781370.1.27424 WP_000781370.1.27426 WP_000781370.1.2745 WP_000781370.1.27451 WP_000781370.1.27504 WP_000781370.1.27518 WP_000781370.1.27520 WP_000781370.1.27524 WP_000781370.1.2755 WP_000781370.1.27560 WP_000781370.1.27580 WP_000781370.1.27585 WP_000781370.1.27611 WP_000781370.1.27618 WP_000781370.1.27683 WP_000781370.1.27691 WP_000781370.1.27698 WP_000781370.1.27723 WP_000781370.1.27741 WP_000781370.1.27742 WP_000781370.1.27749 WP_000781370.1.27758 WP_000781370.1.27786 WP_000781370.1.2779 WP_000781370.1.27797 WP_000781370.1.2782 WP_000781370.1.27846 WP_000781370.1.27856 WP_000781370.1.27871 WP_000781370.1.27876 WP_000781370.1.27879 WP_000781370.1.27897 WP_000781370.1.27911 WP_000781370.1.27913 WP_000781370.1.27923 WP_000781370.1.27932 WP_000781370.1.2794 WP_000781370.1.27971 WP_000781370.1.27998 WP_000781370.1.28008 WP_000781370.1.28026 WP_000781370.1.28027 WP_000781370.1.28046 WP_000781370.1.28051 WP_000781370.1.28102 WP_000781370.1.28109 WP_000781370.1.2811 WP_000781370.1.28110 WP_000781370.1.28128 WP_000781370.1.28145 WP_000781370.1.28156 WP_000781370.1.28168 WP_000781370.1.28184 WP_000781370.1.28199 WP_000781370.1.2823 WP_000781370.1.28250 WP_000781370.1.2826 WP_000781370.1.28268 WP_000781370.1.28305 WP_000781370.1.28314 WP_000781370.1.28322 WP_000781370.1.28345 WP_000781370.1.28349 WP_000781370.1.28371 WP_000781370.1.2838 WP_000781370.1.28401 WP_000781370.1.28414 WP_000781370.1.28433 WP_000781370.1.28440 WP_000781370.1.28461 WP_000781370.1.28476 WP_000781370.1.28480 WP_000781370.1.28496 WP_000781370.1.285 WP_000781370.1.28500 WP_000781370.1.28509 WP_000781370.1.28523 WP_000781370.1.28536 WP_000781370.1.28540 WP_000781370.1.28544 WP_000781370.1.28554 WP_000781370.1.28568 WP_000781370.1.28639 WP_000781370.1.2866 WP_000781370.1.28662 WP_000781370.1.28683 WP_000781370.1.28697 WP_000781370.1.28711 WP_000781370.1.28723 WP_000781370.1.28732 WP_000781370.1.28736 WP_000781370.1.28742 WP_000781370.1.28760 WP_000781370.1.28762 WP_000781370.1.28769 WP_000781370.1.28791 WP_000781370.1.28809 WP_000781370.1.2881 WP_000781370.1.28829 WP_000781370.1.28835 WP_000781370.1.28842 WP_000781370.1.28863 WP_000781370.1.28919 WP_000781370.1.28924 WP_000781370.1.28950 WP_000781370.1.28953 WP_000781370.1.28982 WP_000781370.1.28994 WP_000781370.1.290 WP_000781370.1.29001 WP_000781370.1.29013 WP_000781370.1.29016 WP_000781370.1.29026 WP_000781370.1.29049 WP_000781370.1.29055 WP_000781370.1.29061 WP_000781370.1.29079 WP_000781370.1.29082 WP_000781370.1.29100 WP_000781370.1.29118 WP_000781370.1.29125 WP_000781370.1.29128 WP_000781370.1.29146 WP_000781370.1.29150 WP_000781370.1.29164 WP_000781370.1.29176 WP_000781370.1.29194 WP_000781370.1.29197 WP_000781370.1.29202 WP_000781370.1.29206 WP_000781370.1.29221 WP_000781370.1.29230 WP_000781370.1.29239 WP_000781370.1.29252 WP_000781370.1.29258 WP_000781370.1.2926 WP_000781370.1.29377 WP_000781370.1.29394 WP_000781370.1.2942 WP_000781370.1.29429 WP_000781370.1.29443 WP_000781370.1.2945 WP_000781370.1.29486 WP_000781370.1.29495 WP_000781370.1.29497 WP_000781370.1.29503 WP_000781370.1.29504 WP_000781370.1.29513 WP_000781370.1.2952 WP_000781370.1.29523 WP_000781370.1.2954 WP_000781370.1.29556 WP_000781370.1.29590 WP_000781370.1.29603 WP_000781370.1.2963 WP_000781370.1.29643 WP_000781370.1.29647 WP_000781370.1.29662 WP_000781370.1.29669 WP_000781370.1.29683 WP_000781370.1.29689 WP_000781370.1.29699 WP_000781370.1.29715 WP_000781370.1.29724 WP_000781370.1.29740 WP_000781370.1.29746 WP_000781370.1.29752 WP_000781370.1.29798 WP_000781370.1.29815 WP_000781370.1.29819 WP_000781370.1.29820 WP_000781370.1.29821 WP_000781370.1.29840 WP_000781370.1.29855 WP_000781370.1.2986 WP_000781370.1.29874 WP_000781370.1.29876 WP_000781370.1.29884 WP_000781370.1.29933 WP_000781370.1.2995 WP_000781370.1.29967 WP_000781370.1.29979 WP_000781370.1.29988 WP_000781370.1.30004 WP_000781370.1.30016 WP_000781370.1.30035 WP_000781370.1.30063 WP_000781370.1.30098 WP_000781370.1.30105 WP_000781370.1.30123 WP_000781370.1.30141 WP_000781370.1.3018 WP_000781370.1.30221 WP_000781370.1.30231 WP_000781370.1.30232 WP_000781370.1.30239 WP_000781370.1.30253 WP_000781370.1.30269 WP_000781370.1.30347 WP_000781370.1.30391 WP_000781370.1.30397 WP_000781370.1.30399 WP_000781370.1.30400 WP_000781370.1.30401 WP_000781370.1.30428 WP_000781370.1.30447 WP_000781370.1.3045 WP_000781370.1.30452 WP_000781370.1.30472 WP_000781370.1.30497 WP_000781370.1.30536 WP_000781370.1.30546 WP_000781370.1.3055 WP_000781370.1.30554 WP_000781370.1.30570 WP_000781370.1.30580 WP_000781370.1.306 WP_000781370.1.3063 WP_000781370.1.30630 WP_000781370.1.30639 WP_000781370.1.30658 WP_000781370.1.30665 WP_000781370.1.30700 WP_000781370.1.30733 WP_000781370.1.30742 WP_000781370.1.30749 WP_000781370.1.30762 WP_000781370.1.30783 WP_000781370.1.30808 WP_000781370.1.3083 WP_000781370.1.30843 WP_000781370.1.30853 WP_000781370.1.30866 WP_000781370.1.30867 WP_000781370.1.30879 WP_000781370.1.30887 WP_000781370.1.30896 WP_000781370.1.309 WP_000781370.1.30905 WP_000781370.1.30906 WP_000781370.1.30960 WP_000781370.1.30987 WP_000781370.1.31000 WP_000781370.1.31009 WP_000781370.1.31017 WP_000781370.1.31026 WP_000781370.1.31029 WP_000781370.1.31083 WP_000781370.1.31089 WP_000781370.1.31119 WP_000781370.1.31129 WP_000781370.1.31149 WP_000781370.1.31154 WP_000781370.1.31188 WP_000781370.1.31211 WP_000781370.1.31295 WP_000781370.1.31319 WP_000781370.1.31340 WP_000781370.1.31347 WP_000781370.1.31353 WP_000781370.1.31357 WP_000781370.1.31372 WP_000781370.1.31379 WP_000781370.1.31407 WP_000781370.1.31421 WP_000781370.1.31422 WP_000781370.1.31429 WP_000781370.1.31433 WP_000781370.1.31434 WP_000781370.1.3147 WP_000781370.1.31482 WP_000781370.1.31506 WP_000781370.1.31509 WP_000781370.1.31511 WP_000781370.1.31518 WP_000781370.1.31521 WP_000781370.1.31527 WP_000781370.1.31542 WP_000781370.1.31557 WP_000781370.1.31559 WP_000781370.1.31596 WP_000781370.1.31614 WP_000781370.1.31618 WP_000781370.1.31625 WP_000781370.1.31639 WP_000781370.1.31657 WP_000781370.1.31679 WP_000781370.1.31681 WP_000781370.1.3169 WP_000781370.1.31696 WP_000781370.1.31709 WP_000781370.1.31736 WP_000781370.1.31740 WP_000781370.1.31801 WP_000781370.1.31803 WP_000781370.1.31809 WP_000781370.1.3181 WP_000781370.1.31823 WP_000781370.1.31825 WP_000781370.1.31833 WP_000781370.1.31835 WP_000781370.1.31839 WP_000781370.1.31860 WP_000781370.1.31863 WP_000781370.1.31866 WP_000781370.1.31878 WP_000781370.1.31898 WP_000781370.1.31899 WP_000781370.1.31903 WP_000781370.1.31924 WP_000781370.1.31928 WP_000781370.1.3193 WP_000781370.1.31978 WP_000781370.1.3201 WP_000781370.1.32020 WP_000781370.1.32021 WP_000781370.1.32024 WP_000781370.1.3203 WP_000781370.1.32030 WP_000781370.1.32037 WP_000781370.1.32049 WP_000781370.1.32078 WP_000781370.1.32089 WP_000781370.1.32093 WP_000781370.1.32094 WP_000781370.1.32121 WP_000781370.1.32127 WP_000781370.1.32142 WP_000781370.1.32143 WP_000781370.1.3215 WP_000781370.1.32173 WP_000781370.1.32184 WP_000781370.1.32222 WP_000781370.1.32225 WP_000781370.1.32232 WP_000781370.1.32234 WP_000781370.1.32236 WP_000781370.1.32242 WP_000781370.1.32279 WP_000781370.1.32287 WP_000781370.1.32333 WP_000781370.1.32394 WP_000781370.1.32406 WP_000781370.1.32432 WP_000781370.1.32435 WP_000781370.1.32443 WP_000781370.1.32448 WP_000781370.1.3247 WP_000781370.1.32475 WP_000781370.1.32478 WP_000781370.1.32479 WP_000781370.1.3248 WP_000781370.1.32480 WP_000781370.1.32494 WP_000781370.1.32509 WP_000781370.1.32518 WP_000781370.1.32558 WP_000781370.1.32561 WP_000781370.1.32580 WP_000781370.1.3259 WP_000781370.1.32591 WP_000781370.1.32601 WP_000781370.1.32635 WP_000781370.1.32650 WP_000781370.1.32655 WP_000781370.1.32661 WP_000781370.1.32676 WP_000781370.1.32680 WP_000781370.1.3269 WP_000781370.1.327 WP_000781370.1.32709 WP_000781370.1.32715 WP_000781370.1.32720 WP_000781370.1.32722 WP_000781370.1.32724 WP_000781370.1.32741 WP_000781370.1.32748 WP_000781370.1.32772 WP_000781370.1.32811 WP_000781370.1.32815 WP_000781370.1.32831 WP_000781370.1.32835 WP_000781370.1.32875 WP_000781370.1.32903 WP_000781370.1.32910 WP_000781370.1.32938 WP_000781370.1.32946 WP_000781370.1.32959 WP_000781370.1.32972 WP_000781370.1.32984 WP_000781370.1.32992 WP_000781370.1.32995 WP_000781370.1.33004 WP_000781370.1.33014 WP_000781370.1.33018 WP_000781370.1.33022 WP_000781370.1.33026 WP_000781370.1.33046 WP_000781370.1.33101 WP_000781370.1.33119 WP_000781370.1.33171 WP_000781370.1.33179 WP_000781370.1.33190 WP_000781370.1.33217 WP_000781370.1.33222 WP_000781370.1.3323 WP_000781370.1.33237 WP_000781370.1.33238 WP_000781370.1.33244 WP_000781370.1.33303 WP_000781370.1.33325 WP_000781370.1.33341 WP_000781370.1.33352 WP_000781370.1.33362 WP_000781370.1.33369 WP_000781370.1.33385 WP_000781370.1.334 WP_000781370.1.33408 WP_000781370.1.33410 WP_000781370.1.33413 WP_000781370.1.33422 WP_000781370.1.33424 WP_000781370.1.33428 WP_000781370.1.3344 WP_000781370.1.33475 WP_000781370.1.33476 WP_000781370.1.33502 WP_000781370.1.33512 WP_000781370.1.33525 WP_000781370.1.3354 WP_000781370.1.33545 WP_000781370.1.33561 WP_000781370.1.33563 WP_000781370.1.33565 WP_000781370.1.33584 WP_000781370.1.33595 WP_000781370.1.33631 WP_000781370.1.33638 WP_000781370.1.33648 WP_000781370.1.33667 WP_000781370.1.33680 WP_000781370.1.33729 WP_000781370.1.33736 WP_000781370.1.33745 WP_000781370.1.33746 WP_000781370.1.33751 WP_000781370.1.33780 WP_000781370.1.33799 WP_000781370.1.33823 WP_000781370.1.33853 WP_000781370.1.33854 WP_000781370.1.33888 WP_000781370.1.33896 WP_000781370.1.33914 WP_000781370.1.33948 WP_000781370.1.33952 WP_000781370.1.33973 WP_000781370.1.33974 WP_000781370.1.33979 WP_000781370.1.3398 WP_000781370.1.34003 WP_000781370.1.3401 WP_000781370.1.34032 WP_000781370.1.34094 WP_000781370.1.3411 WP_000781370.1.34117 WP_000781370.1.34121 WP_000781370.1.34122 WP_000781370.1.34124 WP_000781370.1.34130 WP_000781370.1.34144 WP_000781370.1.3415 WP_000781370.1.342 WP_000781370.1.34204 WP_000781370.1.34206 WP_000781370.1.34208 WP_000781370.1.34270 WP_000781370.1.34273 WP_000781370.1.34277 WP_000781370.1.34294 WP_000781370.1.34303 WP_000781370.1.3432 WP_000781370.1.34332 WP_000781370.1.34341 WP_000781370.1.34348 WP_000781370.1.34362 WP_000781370.1.34363 WP_000781370.1.34380 WP_000781370.1.34397 WP_000781370.1.34400 WP_000781370.1.34422 WP_000781370.1.3444 WP_000781370.1.34440 WP_000781370.1.34441 WP_000781370.1.34444 WP_000781370.1.34456 WP_000781370.1.34464 WP_000781370.1.34470 WP_000781370.1.34525 WP_000781370.1.34528 WP_000781370.1.34532 WP_000781370.1.34538 WP_000781370.1.34541 WP_000781370.1.34557 WP_000781370.1.34558 WP_000781370.1.3460 WP_000781370.1.34605 WP_000781370.1.34617 WP_000781370.1.34655 WP_000781370.1.34668 WP_000781370.1.34675 WP_000781370.1.34682 WP_000781370.1.34683 WP_000781370.1.347 WP_000781370.1.34727 WP_000781370.1.34763 WP_000781370.1.34781 WP_000781370.1.34782 WP_000781370.1.34794 WP_000781370.1.34827 WP_000781370.1.34835 WP_000781370.1.34838 WP_000781370.1.34855 WP_000781370.1.34875 WP_000781370.1.34887 WP_000781370.1.34913 WP_000781370.1.34931 WP_000781370.1.34948 WP_000781370.1.34966 WP_000781370.1.34982 WP_000781370.1.34983 WP_000781370.1.34990 WP_000781370.1.34993 WP_000781370.1.35006 WP_000781370.1.35007 WP_000781370.1.35012 WP_000781370.1.35039 WP_000781370.1.35107 WP_000781370.1.35114 WP_000781370.1.35127 WP_000781370.1.35132 WP_000781370.1.3515 WP_000781370.1.35168 WP_000781370.1.35180 WP_000781370.1.35186 WP_000781370.1.35198 WP_000781370.1.35202 WP_000781370.1.35204 WP_000781370.1.3521 WP_000781370.1.35211 WP_000781370.1.35220 WP_000781370.1.35253 WP_000781370.1.35258 WP_000781370.1.35316 WP_000781370.1.35328 WP_000781370.1.35360 WP_000781370.1.35365 WP_000781370.1.35376 WP_000781370.1.3539 WP_000781370.1.35394 WP_000781370.1.35398 WP_000781370.1.35448 WP_000781370.1.35464 WP_000781370.1.35465 WP_000781370.1.35466 WP_000781370.1.35468 WP_000781370.1.35483 WP_000781370.1.35552 WP_000781370.1.35578 WP_000781370.1.35581 WP_000781370.1.3560 WP_000781370.1.35604 WP_000781370.1.35627 WP_000781370.1.35651 WP_000781370.1.35653 WP_000781370.1.35654 WP_000781370.1.35704 WP_000781370.1.35724 WP_000781370.1.35740 WP_000781370.1.35741 WP_000781370.1.35744 WP_000781370.1.35789 WP_000781370.1.35889 WP_000781370.1.35904 WP_000781370.1.35922 WP_000781370.1.35927 WP_000781370.1.35934 WP_000781370.1.35959 WP_000781370.1.35963 WP_000781370.1.3598 WP_000781370.1.35983 WP_000781370.1.35985 WP_000781370.1.35987 WP_000781370.1.35990 WP_000781370.1.3600 WP_000781370.1.36040 WP_000781370.1.36042 WP_000781370.1.36070 WP_000781370.1.36071 WP_000781370.1.36085 WP_000781370.1.36094 WP_000781370.1.36105 WP_000781370.1.36132 WP_000781370.1.36158 WP_000781370.1.36159 WP_000781370.1.36164 WP_000781370.1.36166 WP_000781370.1.36177 WP_000781370.1.36182 WP_000781370.1.3620 WP_000781370.1.3624 WP_000781370.1.36281 WP_000781370.1.36299 WP_000781370.1.36332 WP_000781370.1.36334 WP_000781370.1.36352 WP_000781370.1.36386 WP_000781370.1.36393 WP_000781370.1.36405 WP_000781370.1.36412 WP_000781370.1.36426 WP_000781370.1.3643 WP_000781370.1.36453 WP_000781370.1.36459 WP_000781370.1.36500 WP_000781370.1.36507 WP_000781370.1.36523 WP_000781370.1.36531 WP_000781370.1.36537 WP_000781370.1.36545 WP_000781370.1.36610 WP_000781370.1.36627 WP_000781370.1.36628 WP_000781370.1.36667 WP_000781370.1.3668 WP_000781370.1.36699 WP_000781370.1.3671 WP_000781370.1.36724 WP_000781370.1.36739 WP_000781370.1.36746 WP_000781370.1.36747 WP_000781370.1.36761 WP_000781370.1.36786 WP_000781370.1.36799 WP_000781370.1.36806 WP_000781370.1.36812 WP_000781370.1.36817 WP_000781370.1.36826 WP_000781370.1.36833 WP_000781370.1.36856 WP_000781370.1.36886 WP_000781370.1.36894 WP_000781370.1.36904 WP_000781370.1.36925 WP_000781370.1.3697 WP_000781370.1.36971 WP_000781370.1.36975 WP_000781370.1.37006 WP_000781370.1.37020 WP_000781370.1.37032 WP_000781370.1.37046 WP_000781370.1.37049 WP_000781370.1.37057 WP_000781370.1.37076 WP_000781370.1.37099 WP_000781370.1.37101 WP_000781370.1.37103 WP_000781370.1.37122 WP_000781370.1.37146 WP_000781370.1.37153 WP_000781370.1.37206 WP_000781370.1.3723 WP_000781370.1.37233 WP_000781370.1.37252 WP_000781370.1.37261 WP_000781370.1.37266 WP_000781370.1.37290 WP_000781370.1.3730 WP_000781370.1.37306 WP_000781370.1.37312 WP_000781370.1.37313 WP_000781370.1.37329 WP_000781370.1.37334 WP_000781370.1.37342 WP_000781370.1.37352 WP_000781370.1.37360 WP_000781370.1.37371 WP_000781370.1.37388 WP_000781370.1.37419 WP_000781370.1.37423 WP_000781370.1.37433 WP_000781370.1.37445 WP_000781370.1.37476 WP_000781370.1.37477 WP_000781370.1.37485 WP_000781370.1.3749 WP_000781370.1.37510 WP_000781370.1.37538 WP_000781370.1.37543 WP_000781370.1.37544 WP_000781370.1.37550 WP_000781370.1.37554 WP_000781370.1.37576 WP_000781370.1.37588 WP_000781370.1.37592 WP_000781370.1.37608 WP_000781370.1.37634 WP_000781370.1.37664 WP_000781370.1.377 WP_000781370.1.3772 WP_000781370.1.37736 WP_000781370.1.37745 WP_000781370.1.37750 WP_000781370.1.37758 WP_000781370.1.37762 WP_000781370.1.37773 WP_000781370.1.37817 WP_000781370.1.37847 WP_000781370.1.37852 WP_000781370.1.37853 WP_000781370.1.3788 WP_000781370.1.37880 WP_000781370.1.37887 WP_000781370.1.37897 WP_000781370.1.37917 WP_000781370.1.37923 WP_000781370.1.37926 WP_000781370.1.37940 WP_000781370.1.3796 WP_000781370.1.37962 WP_000781370.1.37964 WP_000781370.1.37967 WP_000781370.1.37984 WP_000781370.1.37995 WP_000781370.1.37998 WP_000781370.1.38000 WP_000781370.1.38033 WP_000781370.1.38043 WP_000781370.1.38080 WP_000781370.1.38081 WP_000781370.1.38085 WP_000781370.1.38103 WP_000781370.1.38105 WP_000781370.1.3811 WP_000781370.1.38120 WP_000781370.1.38155 WP_000781370.1.38162 WP_000781370.1.38182 WP_000781370.1.38185 WP_000781370.1.38194 WP_000781370.1.38211 WP_000781370.1.3822 WP_000781370.1.38234 WP_000781370.1.38257 WP_000781370.1.38264 WP_000781370.1.38293 WP_000781370.1.38300 WP_000781370.1.38314 WP_000781370.1.38323 WP_000781370.1.38357 WP_000781370.1.38363 WP_000781370.1.38371 WP_000781370.1.38392 WP_000781370.1.38412 WP_000781370.1.38419 WP_000781370.1.38485 WP_000781370.1.38533 WP_000781370.1.38561 WP_000781370.1.38567 WP_000781370.1.38584 WP_000781370.1.38610 WP_000781370.1.38626 WP_000781370.1.38629 WP_000781370.1.38636 WP_000781370.1.38694 WP_000781370.1.38722 WP_000781370.1.3873 WP_000781370.1.38777 WP_000781370.1.38782 WP_000781370.1.38811 WP_000781370.1.38827 WP_000781370.1.38843 WP_000781370.1.38896 WP_000781370.1.38911 WP_000781370.1.38920 WP_000781370.1.38935 WP_000781370.1.38937 WP_000781370.1.38956 WP_000781370.1.39005 WP_000781370.1.39015 WP_000781370.1.3903 WP_000781370.1.39037 WP_000781370.1.3904 WP_000781370.1.39042 WP_000781370.1.39103 WP_000781370.1.39111 WP_000781370.1.3912 WP_000781370.1.39123 WP_000781370.1.39150 WP_000781370.1.39155 WP_000781370.1.39157 WP_000781370.1.39164 WP_000781370.1.39167 WP_000781370.1.39171 WP_000781370.1.39184 WP_000781370.1.39196 WP_000781370.1.39209 WP_000781370.1.3921 WP_000781370.1.3922 WP_000781370.1.39249 WP_000781370.1.39254 WP_000781370.1.39289 WP_000781370.1.39302 WP_000781370.1.39305 WP_000781370.1.39313 WP_000781370.1.39325 WP_000781370.1.39327 WP_000781370.1.39342 WP_000781370.1.39356 WP_000781370.1.39365 WP_000781370.1.39367 WP_000781370.1.39373 WP_000781370.1.39401 WP_000781370.1.39402 WP_000781370.1.39423 WP_000781370.1.39430 WP_000781370.1.39468 WP_000781370.1.39481 WP_000781370.1.39492 WP_000781370.1.39509 WP_000781370.1.39531 WP_000781370.1.3954 WP_000781370.1.39541 WP_000781370.1.39575 WP_000781370.1.39580 WP_000781370.1.39594 WP_000781370.1.39606 WP_000781370.1.39607 WP_000781370.1.39610 WP_000781370.1.39636 WP_000781370.1.39651 WP_000781370.1.39690 WP_000781370.1.3970 WP_000781370.1.39708 WP_000781370.1.39709 WP_000781370.1.39713 WP_000781370.1.39715 WP_000781370.1.39717 WP_000781370.1.39726 WP_000781370.1.39730 WP_000781370.1.39733 WP_000781370.1.39734 WP_000781370.1.39758 WP_000781370.1.39780 WP_000781370.1.39796 WP_000781370.1.3980 WP_000781370.1.39809 WP_000781370.1.39818 WP_000781370.1.39822 WP_000781370.1.39829 WP_000781370.1.39867 WP_000781370.1.39870 WP_000781370.1.39892 WP_000781370.1.39938 WP_000781370.1.39961 WP_000781370.1.39966 WP_000781370.1.39970 WP_000781370.1.39973 WP_000781370.1.39992 WP_000781370.1.39998 WP_000781370.1.40 WP_000781370.1.40013 WP_000781370.1.40016 WP_000781370.1.40019 WP_000781370.1.4005 WP_000781370.1.40083 WP_000781370.1.40088 WP_000781370.1.40107 WP_000781370.1.40121 WP_000781370.1.40140 WP_000781370.1.40147 WP_000781370.1.40153 WP_000781370.1.40159 WP_000781370.1.40183 WP_000781370.1.40190 WP_000781370.1.40192 WP_000781370.1.4020 WP_000781370.1.40206 WP_000781370.1.40211 WP_000781370.1.40212 WP_000781370.1.40218 WP_000781370.1.40238 WP_000781370.1.40249 WP_000781370.1.40298 WP_000781370.1.40300 WP_000781370.1.40315 WP_000781370.1.40317 WP_000781370.1.40319 WP_000781370.1.40335 WP_000781370.1.40345 WP_000781370.1.40349 WP_000781370.1.40360 WP_000781370.1.40382 WP_000781370.1.40389 WP_000781370.1.40391 WP_000781370.1.40403 WP_000781370.1.40445 WP_000781370.1.40486 WP_000781370.1.4049 WP_000781370.1.40499 WP_000781370.1.40502 WP_000781370.1.40509 WP_000781370.1.40524 WP_000781370.1.40539 WP_000781370.1.40548 WP_000781370.1.40560 WP_000781370.1.40563 WP_000781370.1.40596 WP_000781370.1.40599 WP_000781370.1.406 WP_000781370.1.40607 WP_000781370.1.40617 WP_000781370.1.40623 WP_000781370.1.40636 WP_000781370.1.40657 WP_000781370.1.40660 WP_000781370.1.40666 WP_000781370.1.40668 WP_000781370.1.40686 WP_000781370.1.40712 WP_000781370.1.40715 WP_000781370.1.40781 WP_000781370.1.4081 WP_000781370.1.40813 WP_000781370.1.40815 WP_000781370.1.4082 WP_000781370.1.40842 WP_000781370.1.40843 WP_000781370.1.40865 WP_000781370.1.40893 WP_000781370.1.40898 WP_000781370.1.40912 WP_000781370.1.40937 WP_000781370.1.40965 WP_000781370.1.41041 WP_000781370.1.41045 WP_000781370.1.41063 WP_000781370.1.41078 WP_000781370.1.41113 WP_000781370.1.41125 WP_000781370.1.41147 WP_000781370.1.41206 WP_000781370.1.4122 WP_000781370.1.41230 WP_000781370.1.41239 WP_000781370.1.41244 WP_000781370.1.41259 WP_000781370.1.4126 WP_000781370.1.41263 WP_000781370.1.41271 WP_000781370.1.41287 WP_000781370.1.41315 WP_000781370.1.41332 WP_000781370.1.41346 WP_000781370.1.41363 WP_000781370.1.41368 WP_000781370.1.41371 WP_000781370.1.41392 WP_000781370.1.41394 WP_000781370.1.41401 WP_000781370.1.41402 WP_000781370.1.41407 WP_000781370.1.41417 WP_000781370.1.4142 WP_000781370.1.41436 WP_000781370.1.41453 WP_000781370.1.41455 WP_000781370.1.41466 WP_000781370.1.41479 WP_000781370.1.41481 WP_000781370.1.41482 WP_000781370.1.41483 WP_000781370.1.41484 WP_000781370.1.41530 WP_000781370.1.41545 WP_000781370.1.41556 WP_000781370.1.41566 WP_000781370.1.4158 WP_000781370.1.41606 WP_000781370.1.41613 WP_000781370.1.41621 WP_000781370.1.41651 WP_000781370.1.41654 WP_000781370.1.41712 WP_000781370.1.41718 WP_000781370.1.4172 WP_000781370.1.41740 WP_000781370.1.41741 WP_000781370.1.41752 WP_000781370.1.41778 WP_000781370.1.41780 WP_000781370.1.41782 WP_000781370.1.41783 WP_000781370.1.41784 WP_000781370.1.41809 WP_000781370.1.41812 WP_000781370.1.41826 WP_000781370.1.41837 WP_000781370.1.41847 WP_000781370.1.41884 WP_000781370.1.41885 WP_000781370.1.4189 WP_000781370.1.41900 WP_000781370.1.41923 WP_000781370.1.4193 WP_000781370.1.41956 WP_000781370.1.41960 WP_000781370.1.41964 WP_000781370.1.41988 WP_000781370.1.41990 WP_000781370.1.41991 WP_000781370.1.42022 WP_000781370.1.42027 WP_000781370.1.42033 WP_000781370.1.42038 WP_000781370.1.42044 WP_000781370.1.42060 WP_000781370.1.42073 WP_000781370.1.42095 WP_000781370.1.42096 WP_000781370.1.42113 WP_000781370.1.42138 WP_000781370.1.42151 WP_000781370.1.42159 WP_000781370.1.42179 WP_000781370.1.42203 WP_000781370.1.42209 WP_000781370.1.42214 WP_000781370.1.42221 WP_000781370.1.42226 WP_000781370.1.42228 WP_000781370.1.42233 WP_000781370.1.4224 WP_000781370.1.42252 WP_000781370.1.42277 WP_000781370.1.42284 WP_000781370.1.42300 WP_000781370.1.42318 WP_000781370.1.42350 WP_000781370.1.42359 WP_000781370.1.42367 WP_000781370.1.42369 WP_000781370.1.42376 WP_000781370.1.42387 WP_000781370.1.42413 WP_000781370.1.42415 WP_000781370.1.4242 WP_000781370.1.42432 WP_000781370.1.42442 WP_000781370.1.42443 WP_000781370.1.42456 WP_000781370.1.42480 WP_000781370.1.42516 WP_000781370.1.42522 WP_000781370.1.42586 WP_000781370.1.42597 WP_000781370.1.42600 WP_000781370.1.42601 WP_000781370.1.42632 WP_000781370.1.42638 WP_000781370.1.42661 WP_000781370.1.42669 WP_000781370.1.42670 WP_000781370.1.42677 WP_000781370.1.42709 WP_000781370.1.42728 WP_000781370.1.42748 WP_000781370.1.42749 WP_000781370.1.42750 WP_000781370.1.42756 WP_000781370.1.42761 WP_000781370.1.42770 WP_000781370.1.42771 WP_000781370.1.42791 WP_000781370.1.42804 WP_000781370.1.42808 WP_000781370.1.42813 WP_000781370.1.4282 WP_000781370.1.42828 WP_000781370.1.42830 WP_000781370.1.42832 WP_000781370.1.42879 WP_000781370.1.42880 WP_000781370.1.42891 WP_000781370.1.4290 WP_000781370.1.42903 WP_000781370.1.42918 WP_000781370.1.42936 WP_000781370.1.42937 WP_000781370.1.42950 WP_000781370.1.42962 WP_000781370.1.42966 WP_000781370.1.42970 WP_000781370.1.42987 WP_000781370.1.42989 WP_000781370.1.42991 WP_000781370.1.43035 WP_000781370.1.4306 WP_000781370.1.43123 WP_000781370.1.43132 WP_000781370.1.43137 WP_000781370.1.43166 WP_000781370.1.43170 WP_000781370.1.43174 WP_000781370.1.43177 WP_000781370.1.43213 WP_000781370.1.43216 WP_000781370.1.43239 WP_000781370.1.43270 WP_000781370.1.43278 WP_000781370.1.43316 WP_000781370.1.43324 WP_000781370.1.4334 WP_000781370.1.43363 WP_000781370.1.43374 WP_000781370.1.43389 WP_000781370.1.4342 WP_000781370.1.43422 WP_000781370.1.43427 WP_000781370.1.4343 WP_000781370.1.43444 WP_000781370.1.43455 WP_000781370.1.43473 WP_000781370.1.43474 WP_000781370.1.43489 WP_000781370.1.43501 WP_000781370.1.4356 WP_000781370.1.43566 WP_000781370.1.43598 WP_000781370.1.436 WP_000781370.1.43622 WP_000781370.1.43642 WP_000781370.1.43720 WP_000781370.1.43733 WP_000781370.1.43738 WP_000781370.1.43750 WP_000781370.1.43769 WP_000781370.1.43803 WP_000781370.1.43804 WP_000781370.1.43858 WP_000781370.1.43868 WP_000781370.1.43918 WP_000781370.1.43925 WP_000781370.1.43942 WP_000781370.1.43953 WP_000781370.1.43966 WP_000781370.1.43989 WP_000781370.1.440 WP_000781370.1.4400 WP_000781370.1.44018 WP_000781370.1.44020 WP_000781370.1.44029 WP_000781370.1.44040 WP_000781370.1.44051 WP_000781370.1.44075 WP_000781370.1.44077 WP_000781370.1.44088 WP_000781370.1.44096 WP_000781370.1.44100 WP_000781370.1.4411 WP_000781370.1.44115 WP_000781370.1.44130 WP_000781370.1.4415 WP_000781370.1.44162 WP_000781370.1.44166 WP_000781370.1.44201 WP_000781370.1.44211 WP_000781370.1.44238 WP_000781370.1.44251 WP_000781370.1.44263 WP_000781370.1.44264 WP_000781370.1.44273 WP_000781370.1.44285 WP_000781370.1.44287 WP_000781370.1.44292 WP_000781370.1.44314 WP_000781370.1.44324 WP_000781370.1.44327 WP_000781370.1.44354 WP_000781370.1.44365 WP_000781370.1.44394 WP_000781370.1.44422 WP_000781370.1.44424 WP_000781370.1.44426 WP_000781370.1.44445 WP_000781370.1.44447 WP_000781370.1.44452 WP_000781370.1.44458 WP_000781370.1.44460 WP_000781370.1.44461 WP_000781370.1.4449 WP_000781370.1.44524 WP_000781370.1.44539 WP_000781370.1.4454 WP_000781370.1.44558 WP_000781370.1.44570 WP_000781370.1.44587 WP_000781370.1.4459 WP_000781370.1.44608 WP_000781370.1.44610 WP_000781370.1.44622 WP_000781370.1.4463 WP_000781370.1.44642 WP_000781370.1.44649 WP_000781370.1.44661 WP_000781370.1.44686 WP_000781370.1.4471 WP_000781370.1.44717 WP_000781370.1.44724 WP_000781370.1.4473 WP_000781370.1.44756 WP_000781370.1.44759 WP_000781370.1.44784 WP_000781370.1.448 WP_000781370.1.44800 WP_000781370.1.44814 WP_000781370.1.44818 WP_000781370.1.44821 WP_000781370.1.44836 WP_000781370.1.44840 WP_000781370.1.44841 WP_000781370.1.44843 WP_000781370.1.44848 WP_000781370.1.44849 WP_000781370.1.44854 WP_000781370.1.44855 WP_000781370.1.44857 WP_000781370.1.44923 WP_000781370.1.44960 WP_000781370.1.44961 WP_000781370.1.44970 WP_000781370.1.44977 WP_000781370.1.44980 WP_000781370.1.45025 WP_000781370.1.45028 WP_000781370.1.45043 WP_000781370.1.45053 WP_000781370.1.45068 WP_000781370.1.45104 WP_000781370.1.45156 WP_000781370.1.4516 WP_000781370.1.45208 WP_000781370.1.4524 WP_000781370.1.45246 WP_000781370.1.4530 WP_000781370.1.45301 WP_000781370.1.45313 WP_000781370.1.45329 WP_000781370.1.45359 WP_000781370.1.4538 WP_000781370.1.45405 WP_000781370.1.4541 WP_000781370.1.45440 WP_000781370.1.45444 WP_000781370.1.45486 WP_000781370.1.45494 WP_000781370.1.45500 WP_000781370.1.45525 WP_000781370.1.45536 WP_000781370.1.45538 WP_000781370.1.45581 WP_000781370.1.45595 WP_000781370.1.45600 WP_000781370.1.45627 WP_000781370.1.4563 WP_000781370.1.45664 WP_000781370.1.45674 WP_000781370.1.45676 WP_000781370.1.4570 WP_000781370.1.45718 WP_000781370.1.4574 WP_000781370.1.45740 WP_000781370.1.45741 WP_000781370.1.45752 WP_000781370.1.4576 WP_000781370.1.45789 WP_000781370.1.45793 WP_000781370.1.45801 WP_000781370.1.45806 WP_000781370.1.4583 WP_000781370.1.45840 WP_000781370.1.45846 WP_000781370.1.45865 WP_000781370.1.45868 WP_000781370.1.45891 WP_000781370.1.45921 WP_000781370.1.4593 WP_000781370.1.45930 WP_000781370.1.45933 WP_000781370.1.45945 WP_000781370.1.45960 WP_000781370.1.45962 WP_000781370.1.45968 WP_000781370.1.45990 WP_000781370.1.45991 WP_000781370.1.4600 WP_000781370.1.46016 WP_000781370.1.46026 WP_000781370.1.46027 WP_000781370.1.46048 WP_000781370.1.46049 WP_000781370.1.46070 WP_000781370.1.46081 WP_000781370.1.46097 WP_000781370.1.4610 WP_000781370.1.46105 WP_000781370.1.46115 WP_000781370.1.4613 WP_000781370.1.46164 WP_000781370.1.4617 WP_000781370.1.46186 WP_000781370.1.46197 WP_000781370.1.46213 WP_000781370.1.46217 WP_000781370.1.46239 WP_000781370.1.46245 WP_000781370.1.46257 WP_000781370.1.46263 WP_000781370.1.46291 WP_000781370.1.46301 WP_000781370.1.46325 WP_000781370.1.46329 WP_000781370.1.46378 WP_000781370.1.46379 WP_000781370.1.4643 WP_000781370.1.46433 WP_000781370.1.46438 WP_000781370.1.46441 WP_000781370.1.4646 WP_000781370.1.46468 WP_000781370.1.4647 WP_000781370.1.46477 WP_000781370.1.46487 WP_000781370.1.46526 WP_000781370.1.46531 WP_000781370.1.46541 WP_000781370.1.46552 WP_000781370.1.46555 WP_000781370.1.4657 WP_000781370.1.46573 WP_000781370.1.46582 WP_000781370.1.46589 WP_000781370.1.46594 WP_000781370.1.46614 WP_000781370.1.46616 WP_000781370.1.46643 WP_000781370.1.46655 WP_000781370.1.46668 WP_000781370.1.4670 WP_000781370.1.46734 WP_000781370.1.46743 WP_000781370.1.46795 WP_000781370.1.46798 WP_000781370.1.46802 WP_000781370.1.46806 WP_000781370.1.46820 WP_000781370.1.46821 WP_000781370.1.46833 WP_000781370.1.46841 WP_000781370.1.46857 WP_000781370.1.46860 WP_000781370.1.46882 WP_000781370.1.46898 WP_000781370.1.46909 WP_000781370.1.4691 WP_000781370.1.46912 WP_000781370.1.46932 WP_000781370.1.4695 WP_000781370.1.46990 WP_000781370.1.46991 WP_000781370.1.46994 WP_000781370.1.46999 WP_000781370.1.47024 WP_000781370.1.47028 WP_000781370.1.47029 WP_000781370.1.47030 WP_000781370.1.47034 WP_000781370.1.47038 WP_000781370.1.47039 WP_000781370.1.47047 WP_000781370.1.47048 WP_000781370.1.47050 WP_000781370.1.47054 WP_000781370.1.47063 WP_000781370.1.47069 WP_000781370.1.47073 WP_000781370.1.47124 WP_000781370.1.47135 WP_000781370.1.47156 WP_000781370.1.47167 WP_000781370.1.47186 WP_000781370.1.47189 WP_000781370.1.47198 WP_000781370.1.4722 WP_000781370.1.47224 WP_000781370.1.47235 WP_000781370.1.47246 WP_000781370.1.47247 WP_000781370.1.4725 WP_000781370.1.47307 WP_000781370.1.47316 WP_000781370.1.47319 WP_000781370.1.47322 WP_000781370.1.47332 WP_000781370.1.47344 WP_000781370.1.47349 WP_000781370.1.47350 WP_000781370.1.47356 WP_000781370.1.47363 WP_000781370.1.47366 WP_000781370.1.47370 WP_000781370.1.47386 WP_000781370.1.47398 WP_000781370.1.4740 WP_000781370.1.47401 WP_000781370.1.47414 WP_000781370.1.47416 WP_000781370.1.47425 WP_000781370.1.4743 WP_000781370.1.47451 WP_000781370.1.47454 WP_000781370.1.47477 WP_000781370.1.47488 WP_000781370.1.47496 WP_000781370.1.47498 WP_000781370.1.47500 WP_000781370.1.47529 WP_000781370.1.47533 WP_000781370.1.47546 WP_000781370.1.47555 WP_000781370.1.47582 WP_000781370.1.47599 WP_000781370.1.47634 WP_000781370.1.47654 WP_000781370.1.47662 WP_000781370.1.47673 WP_000781370.1.47709 WP_000781370.1.4772 WP_000781370.1.47722 WP_000781370.1.4773 WP_000781370.1.47734 WP_000781370.1.47740 WP_000781370.1.47744 WP_000781370.1.47761 WP_000781370.1.47764 WP_000781370.1.47765 WP_000781370.1.47770 WP_000781370.1.47790 WP_000781370.1.47791 WP_000781370.1.47820 WP_000781370.1.4783 WP_000781370.1.47848 WP_000781370.1.4785 WP_000781370.1.47914 WP_000781370.1.47935 WP_000781370.1.4796 WP_000781370.1.47962 WP_000781370.1.47976 WP_000781370.1.47981 WP_000781370.1.47983 WP_000781370.1.48000 WP_000781370.1.48018 WP_000781370.1.48029 WP_000781370.1.48040 WP_000781370.1.48048 WP_000781370.1.48051 WP_000781370.1.48073 WP_000781370.1.48077 WP_000781370.1.48080 WP_000781370.1.48087 WP_000781370.1.48090 WP_000781370.1.48096 WP_000781370.1.4811 WP_000781370.1.48111 WP_000781370.1.48121 WP_000781370.1.48144 WP_000781370.1.48188 WP_000781370.1.48194 WP_000781370.1.48222 WP_000781370.1.4826 WP_000781370.1.48265 WP_000781370.1.48285 WP_000781370.1.48290 WP_000781370.1.48291 WP_000781370.1.48317 WP_000781370.1.48353 WP_000781370.1.48355 WP_000781370.1.48371 WP_000781370.1.48385 WP_000781370.1.48404 WP_000781370.1.48417 WP_000781370.1.48421 WP_000781370.1.48431 WP_000781370.1.48433 WP_000781370.1.48469 WP_000781370.1.48477 WP_000781370.1.48480 WP_000781370.1.48483 WP_000781370.1.48505 WP_000781370.1.4857 WP_000781370.1.48571 WP_000781370.1.48590 WP_000781370.1.486 WP_000781370.1.48602 WP_000781370.1.48615 WP_000781370.1.48620 WP_000781370.1.48626 WP_000781370.1.48629 WP_000781370.1.48678 WP_000781370.1.48689 WP_000781370.1.4871 WP_000781370.1.48771 WP_000781370.1.48801 WP_000781370.1.48808 WP_000781370.1.48825 WP_000781370.1.48827 WP_000781370.1.48847 WP_000781370.1.48860 WP_000781370.1.48901 WP_000781370.1.48902 WP_000781370.1.48907 WP_000781370.1.48910 WP_000781370.1.4892 WP_000781370.1.48921 WP_000781370.1.48926 WP_000781370.1.48928 WP_000781370.1.48953 WP_000781370.1.48954 WP_000781370.1.48970 WP_000781370.1.48974 WP_000781370.1.49001 WP_000781370.1.49009 WP_000781370.1.49061 WP_000781370.1.49076 WP_000781370.1.49104 WP_000781370.1.49107 WP_000781370.1.49124 WP_000781370.1.49136 WP_000781370.1.49147 WP_000781370.1.49170 WP_000781370.1.49179 WP_000781370.1.49190 WP_000781370.1.49229 WP_000781370.1.49236 WP_000781370.1.49258 WP_000781370.1.49259 WP_000781370.1.49312 WP_000781370.1.49321 WP_000781370.1.49336 WP_000781370.1.49338 WP_000781370.1.49342 WP_000781370.1.49347 WP_000781370.1.49363 WP_000781370.1.49376 WP_000781370.1.49412 WP_000781370.1.49431 WP_000781370.1.49446 WP_000781370.1.49459 WP_000781370.1.49481 WP_000781370.1.49482 WP_000781370.1.49483 WP_000781370.1.4949 WP_000781370.1.49521 WP_000781370.1.49522 WP_000781370.1.49528 WP_000781370.1.49531 WP_000781370.1.49537 WP_000781370.1.49546 WP_000781370.1.49558 WP_000781370.1.49594 WP_000781370.1.49599 WP_000781370.1.49615 WP_000781370.1.49621 WP_000781370.1.49625 WP_000781370.1.49645 WP_000781370.1.49661 WP_000781370.1.49662 WP_000781370.1.49675 WP_000781370.1.49684 WP_000781370.1.497 WP_000781370.1.49712 WP_000781370.1.49722 WP_000781370.1.49733 WP_000781370.1.49740 WP_000781370.1.49747 WP_000781370.1.49768 WP_000781370.1.49774 WP_000781370.1.49777 WP_000781370.1.49783 WP_000781370.1.49788 WP_000781370.1.49794 WP_000781370.1.49820 WP_000781370.1.4985 WP_000781370.1.49856 WP_000781370.1.49861 WP_000781370.1.49879 WP_000781370.1.49883 WP_000781370.1.49884 WP_000781370.1.49900 WP_000781370.1.49902 WP_000781370.1.49941 WP_000781370.1.49950 WP_000781370.1.49954 WP_000781370.1.49972 WP_000781370.1.49987 WP_000781370.1.50006 WP_000781370.1.50008 WP_000781370.1.50036 WP_000781370.1.50056 WP_000781370.1.50058 WP_000781370.1.50078 WP_000781370.1.50098 WP_000781370.1.50119 WP_000781370.1.50136 WP_000781370.1.50146 WP_000781370.1.5017 WP_000781370.1.50179 WP_000781370.1.50182 WP_000781370.1.50187 WP_000781370.1.50191 WP_000781370.1.50196 WP_000781370.1.50207 WP_000781370.1.50214 WP_000781370.1.50228 WP_000781370.1.50230 WP_000781370.1.50258 WP_000781370.1.50262 WP_000781370.1.50266 WP_000781370.1.50269 WP_000781370.1.50270 WP_000781370.1.50273 WP_000781370.1.50278 WP_000781370.1.50329 WP_000781370.1.50353 WP_000781370.1.50361 WP_000781370.1.50366 WP_000781370.1.50381 WP_000781370.1.5040 WP_000781370.1.5041 WP_000781370.1.50412 WP_000781370.1.50418 WP_000781370.1.50427 WP_000781370.1.50446 WP_000781370.1.50452 WP_000781370.1.5046 WP_000781370.1.50539 WP_000781370.1.50548 WP_000781370.1.5056 WP_000781370.1.50564 WP_000781370.1.50585 WP_000781370.1.50586 WP_000781370.1.506 WP_000781370.1.50608 WP_000781370.1.5061 WP_000781370.1.50616 WP_000781370.1.50627 WP_000781370.1.5064 WP_000781370.1.5067 WP_000781370.1.50690 WP_000781370.1.50700 WP_000781370.1.50715 WP_000781370.1.50717 WP_000781370.1.50725 WP_000781370.1.50728 WP_000781370.1.50887 WP_000781370.1.50936 WP_000781370.1.50939 WP_000781370.1.50947 WP_000781370.1.5095 WP_000781370.1.50969 WP_000781370.1.50988 WP_000781370.1.50990 WP_000781370.1.50993 WP_000781370.1.50996 WP_000781370.1.51013 WP_000781370.1.51042 WP_000781370.1.51058 WP_000781370.1.5106 WP_000781370.1.511 WP_000781370.1.51109 WP_000781370.1.51127 WP_000781370.1.51170 WP_000781370.1.51172 WP_000781370.1.51175 WP_000781370.1.51180 WP_000781370.1.51190 WP_000781370.1.51201 WP_000781370.1.51203 WP_000781370.1.51211 WP_000781370.1.5124 WP_000781370.1.51248 WP_000781370.1.51253 WP_000781370.1.51255 WP_000781370.1.51260 WP_000781370.1.51278 WP_000781370.1.5128 WP_000781370.1.51283 WP_000781370.1.51299 WP_000781370.1.51300 WP_000781370.1.51307 WP_000781370.1.51320 WP_000781370.1.51323 WP_000781370.1.51325 WP_000781370.1.51330 WP_000781370.1.51336 WP_000781370.1.51354 WP_000781370.1.51360 WP_000781370.1.51364 WP_000781370.1.51380 WP_000781370.1.51392 WP_000781370.1.51405 WP_000781370.1.51426 WP_000781370.1.51427 WP_000781370.1.51430 WP_000781370.1.5146 WP_000781370.1.51462 WP_000781370.1.51482 WP_000781370.1.51490 WP_000781370.1.51495 WP_000781370.1.51503 WP_000781370.1.51513 WP_000781370.1.51525 WP_000781370.1.5153 WP_000781370.1.51537 WP_000781370.1.51542 WP_000781370.1.51548 WP_000781370.1.51552 WP_000781370.1.5157 WP_000781370.1.5158 WP_000781370.1.51580 WP_000781370.1.51587 WP_000781370.1.51596 WP_000781370.1.51607 WP_000781370.1.51624 WP_000781370.1.51629 WP_000781370.1.51662 WP_000781370.1.51690 WP_000781370.1.51707 WP_000781370.1.51718 WP_000781370.1.5172 WP_000781370.1.51757 WP_000781370.1.51784 WP_000781370.1.518 WP_000781370.1.51804 WP_000781370.1.51837 WP_000781370.1.51839 WP_000781370.1.51869 WP_000781370.1.51881 WP_000781370.1.51896 WP_000781370.1.51899 WP_000781370.1.51906 WP_000781370.1.51944 WP_000781370.1.51968 WP_000781370.1.51979 WP_000781370.1.51985 WP_000781370.1.51988 WP_000781370.1.5199 WP_000781370.1.51999 WP_000781370.1.52002 WP_000781370.1.52011 WP_000781370.1.52020 WP_000781370.1.52044 WP_000781370.1.52048 WP_000781370.1.52062 WP_000781370.1.52076 WP_000781370.1.52085 WP_000781370.1.52098 WP_000781370.1.52111 WP_000781370.1.52126 WP_000781370.1.52127 WP_000781370.1.52135 WP_000781370.1.52137 WP_000781370.1.52171 WP_000781370.1.52186 WP_000781370.1.52200 WP_000781370.1.52211 WP_000781370.1.52213 WP_000781370.1.52214 WP_000781370.1.52225 WP_000781370.1.52230 WP_000781370.1.52236 WP_000781370.1.52240 WP_000781370.1.52243 WP_000781370.1.52249 WP_000781370.1.52257 WP_000781370.1.52258 WP_000781370.1.5227 WP_000781370.1.52270 WP_000781370.1.52271 WP_000781370.1.52272 WP_000781370.1.52299 WP_000781370.1.52304 WP_000781370.1.52305 WP_000781370.1.52313 WP_000781370.1.52324 WP_000781370.1.52328 WP_000781370.1.52333 WP_000781370.1.52363 WP_000781370.1.52378 WP_000781370.1.5239 WP_000781370.1.52399 WP_000781370.1.52413 WP_000781370.1.52419 WP_000781370.1.52421 WP_000781370.1.52492 WP_000781370.1.52524 WP_000781370.1.52542 WP_000781370.1.52554 WP_000781370.1.52558 WP_000781370.1.52567 WP_000781370.1.52568 WP_000781370.1.52601 WP_000781370.1.52612 WP_000781370.1.52631 WP_000781370.1.5265 WP_000781370.1.52662 WP_000781370.1.52691 WP_000781370.1.52704 WP_000781370.1.52710 WP_000781370.1.5272 WP_000781370.1.52735 WP_000781370.1.52755 WP_000781370.1.52762 WP_000781370.1.52771 WP_000781370.1.52774 WP_000781370.1.52777 WP_000781370.1.52780 WP_000781370.1.52801 WP_000781370.1.52804 WP_000781370.1.52846 WP_000781370.1.5285 WP_000781370.1.52852 WP_000781370.1.52853 WP_000781370.1.52855 WP_000781370.1.52881 WP_000781370.1.52895 WP_000781370.1.52908 WP_000781370.1.52913 WP_000781370.1.52942 WP_000781370.1.52962 WP_000781370.1.52995 WP_000781370.1.52996 WP_000781370.1.53012 WP_000781370.1.53020 WP_000781370.1.53021 WP_000781370.1.53027 WP_000781370.1.53095 WP_000781370.1.53099 WP_000781370.1.5310 WP_000781370.1.53110 WP_000781370.1.53123 WP_000781370.1.53155 WP_000781370.1.53162 WP_000781370.1.53186 WP_000781370.1.532 WP_000781370.1.5322 WP_000781370.1.53223 WP_000781370.1.53228 WP_000781370.1.53238 WP_000781370.1.53242 WP_000781370.1.53244 WP_000781370.1.53251 WP_000781370.1.53262 WP_000781370.1.53277 WP_000781370.1.53308 WP_000781370.1.53327 WP_000781370.1.53356 WP_000781370.1.53360 WP_000781370.1.53364 WP_000781370.1.53377 WP_000781370.1.53401 WP_000781370.1.53410 WP_000781370.1.53415 WP_000781370.1.53419 WP_000781370.1.5342 WP_000781370.1.53428 WP_000781370.1.53431 WP_000781370.1.53505 WP_000781370.1.5351 WP_000781370.1.53535 WP_000781370.1.53537 WP_000781370.1.53545 WP_000781370.1.53556 WP_000781370.1.53557 WP_000781370.1.53574 WP_000781370.1.53582 WP_000781370.1.53587 WP_000781370.1.53589 WP_000781370.1.53590 WP_000781370.1.53592 WP_000781370.1.53594 WP_000781370.1.5362 WP_000781370.1.53642 WP_000781370.1.53645 WP_000781370.1.53649 WP_000781370.1.53687 WP_000781370.1.53690 WP_000781370.1.53693 WP_000781370.1.53706 WP_000781370.1.53769 WP_000781370.1.53809 WP_000781370.1.53811 WP_000781370.1.53841 WP_000781370.1.53845 WP_000781370.1.53863 WP_000781370.1.53866 WP_000781370.1.53884 WP_000781370.1.5391 WP_000781370.1.53931 WP_000781370.1.53940 WP_000781370.1.5395 WP_000781370.1.53966 WP_000781370.1.53968 WP_000781370.1.53972 WP_000781370.1.53978 WP_000781370.1.53991 WP_000781370.1.53994 WP_000781370.1.54002 WP_000781370.1.54013 WP_000781370.1.54023 WP_000781370.1.54028 WP_000781370.1.54051 WP_000781370.1.54072 WP_000781370.1.54091 WP_000781370.1.54095 WP_000781370.1.54102 WP_000781370.1.54104 WP_000781370.1.54144 WP_000781370.1.54169 WP_000781370.1.54185 WP_000781370.1.54188 WP_000781370.1.54202 WP_000781370.1.54208 WP_000781370.1.54307 WP_000781370.1.54317 WP_000781370.1.54328 WP_000781370.1.54329 WP_000781370.1.5433 WP_000781370.1.5434 WP_000781370.1.54344 WP_000781370.1.54359 WP_000781370.1.54388 WP_000781370.1.54394 WP_000781370.1.5440 WP_000781370.1.54411 WP_000781370.1.54417 WP_000781370.1.54418 WP_000781370.1.54429 WP_000781370.1.54439 WP_000781370.1.54463 WP_000781370.1.54476 WP_000781370.1.54507 WP_000781370.1.54524 WP_000781370.1.54534 WP_000781370.1.54546 WP_000781370.1.54585 WP_000781370.1.54590 WP_000781370.1.54591 WP_000781370.1.5460 WP_000781370.1.54601 WP_000781370.1.54602 WP_000781370.1.54605 WP_000781370.1.54614 WP_000781370.1.54617 WP_000781370.1.54620 WP_000781370.1.54625 WP_000781370.1.54638 WP_000781370.1.54641 WP_000781370.1.54643 WP_000781370.1.54688 WP_000781370.1.54695 WP_000781370.1.5470 WP_000781370.1.54708 WP_000781370.1.54725 WP_000781370.1.54729 WP_000781370.1.54754 WP_000781370.1.54760 WP_000781370.1.54769 WP_000781370.1.5478 WP_000781370.1.5479 WP_000781370.1.54798 WP_000781370.1.54817 WP_000781370.1.54829 WP_000781370.1.54875 WP_000781370.1.54918 WP_000781370.1.54921 WP_000781370.1.54927 WP_000781370.1.54940 WP_000781370.1.54941 WP_000781370.1.54946 WP_000781370.1.54972 WP_000781370.1.54981 WP_000781370.1.54991 WP_000781370.1.54993 WP_000781370.1.55003 WP_000781370.1.55005 WP_000781370.1.55009 WP_000781370.1.55041 WP_000781370.1.55112 WP_000781370.1.55115 WP_000781370.1.55123 WP_000781370.1.55134 WP_000781370.1.55144 WP_000781370.1.55149 WP_000781370.1.55151 WP_000781370.1.55177 WP_000781370.1.55179 WP_000781370.1.55185 WP_000781370.1.55197 WP_000781370.1.5520 WP_000781370.1.55203 WP_000781370.1.55222 WP_000781370.1.55226 WP_000781370.1.55273 WP_000781370.1.55275 WP_000781370.1.55291 WP_000781370.1.55338 WP_000781370.1.55342 WP_000781370.1.55357 WP_000781370.1.55359 WP_000781370.1.55374 WP_000781370.1.55381 WP_000781370.1.55417 WP_000781370.1.55420 WP_000781370.1.55424 WP_000781370.1.55425 WP_000781370.1.5546 WP_000781370.1.55466 WP_000781370.1.55472 WP_000781370.1.55482 WP_000781370.1.55483 WP_000781370.1.55489 WP_000781370.1.55507 WP_000781370.1.55529 WP_000781370.1.55550 WP_000781370.1.55551 WP_000781370.1.55552 WP_000781370.1.55556 WP_000781370.1.55560 WP_000781370.1.55563 WP_000781370.1.55571 WP_000781370.1.55574 WP_000781370.1.55581 WP_000781370.1.55597 WP_000781370.1.55608 WP_000781370.1.5561 WP_000781370.1.55629 WP_000781370.1.5566 WP_000781370.1.55676 WP_000781370.1.5570 WP_000781370.1.55709 WP_000781370.1.55720 WP_000781370.1.55727 WP_000781370.1.55730 WP_000781370.1.55731 WP_000781370.1.55744 WP_000781370.1.55757 WP_000781370.1.55787 WP_000781370.1.55790 WP_000781370.1.55791 WP_000781370.1.55808 WP_000781370.1.55825 WP_000781370.1.55844 WP_000781370.1.55868 WP_000781370.1.55888 WP_000781370.1.55896 WP_000781370.1.55936 WP_000781370.1.55979 WP_000781370.1.55981 WP_000781370.1.55988 WP_000781370.1.55990 WP_000781370.1.56033 WP_000781370.1.56040 WP_000781370.1.56047 WP_000781370.1.56101 WP_000781370.1.56122 WP_000781370.1.56139 WP_000781370.1.5614 WP_000781370.1.56142 WP_000781370.1.56149 WP_000781370.1.5616 WP_000781370.1.56164 WP_000781370.1.56177 WP_000781370.1.56193 WP_000781370.1.56197 WP_000781370.1.562 WP_000781370.1.56216 WP_000781370.1.56231 WP_000781370.1.56278 WP_000781370.1.56285 WP_000781370.1.56293 WP_000781370.1.56302 WP_000781370.1.5632 WP_000781370.1.56338 WP_000781370.1.56345 WP_000781370.1.56371 WP_000781370.1.56388 WP_000781370.1.56399 WP_000781370.1.56402 WP_000781370.1.56436 WP_000781370.1.56439 WP_000781370.1.56446 WP_000781370.1.56457 WP_000781370.1.5646 WP_000781370.1.56469 WP_000781370.1.5649 WP_000781370.1.56501 WP_000781370.1.56502 WP_000781370.1.56513 WP_000781370.1.56523 WP_000781370.1.56528 WP_000781370.1.56543 WP_000781370.1.56573 WP_000781370.1.56586 WP_000781370.1.56650 WP_000781370.1.56665 WP_000781370.1.56680 WP_000781370.1.56689 WP_000781370.1.5670 WP_000781370.1.56704 WP_000781370.1.56713 WP_000781370.1.56714 WP_000781370.1.56721 WP_000781370.1.56742 WP_000781370.1.56776 WP_000781370.1.56777 WP_000781370.1.56786 WP_000781370.1.56787 WP_000781370.1.56789 WP_000781370.1.56799 WP_000781370.1.56821 WP_000781370.1.56830 WP_000781370.1.56835 WP_000781370.1.56846 WP_000781370.1.5685 WP_000781370.1.56871 WP_000781370.1.56882 WP_000781370.1.56885 WP_000781370.1.56908 WP_000781370.1.56932 WP_000781370.1.56933 WP_000781370.1.56934 WP_000781370.1.56936 WP_000781370.1.56937 WP_000781370.1.56941 WP_000781370.1.56951 WP_000781370.1.56978 WP_000781370.1.56980 WP_000781370.1.56992 WP_000781370.1.57011 WP_000781370.1.57045 WP_000781370.1.57051 WP_000781370.1.57072 WP_000781370.1.57079 WP_000781370.1.57086 WP_000781370.1.57100 WP_000781370.1.57124 WP_000781370.1.57159 WP_000781370.1.57181 WP_000781370.1.57182 WP_000781370.1.57185 WP_000781370.1.57202 WP_000781370.1.57213 WP_000781370.1.57216 WP_000781370.1.57222 WP_000781370.1.57254 WP_000781370.1.57266 WP_000781370.1.57269 WP_000781370.1.57278 WP_000781370.1.57281 WP_000781370.1.57319 WP_000781370.1.57349 WP_000781370.1.57386 WP_000781370.1.57403 WP_000781370.1.57410 WP_000781370.1.57414 WP_000781370.1.5742 WP_000781370.1.57432 WP_000781370.1.57438 WP_000781370.1.57451 WP_000781370.1.5748 WP_000781370.1.57492 WP_000781370.1.57517 WP_000781370.1.57538 WP_000781370.1.57539 WP_000781370.1.57550 WP_000781370.1.57558 WP_000781370.1.57574 WP_000781370.1.57588 WP_000781370.1.57608 WP_000781370.1.57628 WP_000781370.1.57629 WP_000781370.1.57634 WP_000781370.1.57638 WP_000781370.1.57659 WP_000781370.1.57663 WP_000781370.1.57669 WP_000781370.1.57719 WP_000781370.1.57738 WP_000781370.1.57812 WP_000781370.1.57814 WP_000781370.1.57832 WP_000781370.1.57846 WP_000781370.1.57851 WP_000781370.1.57854 WP_000781370.1.57898 WP_000781370.1.57903 WP_000781370.1.57904 WP_000781370.1.57920 WP_000781370.1.57951 WP_000781370.1.57975 WP_000781370.1.57982 WP_000781370.1.57983 WP_000781370.1.57994 WP_000781370.1.58001 WP_000781370.1.58009 WP_000781370.1.58022 WP_000781370.1.58038 WP_000781370.1.58045 WP_000781370.1.58060 WP_000781370.1.58080 WP_000781370.1.58094 WP_000781370.1.58097 WP_000781370.1.58098 WP_000781370.1.5810 WP_000781370.1.58107 WP_000781370.1.5812 WP_000781370.1.58128 WP_000781370.1.58143 WP_000781370.1.58146 WP_000781370.1.58163 WP_000781370.1.58172 WP_000781370.1.58206 WP_000781370.1.58226 WP_000781370.1.58232 WP_000781370.1.58233 WP_000781370.1.58244 WP_000781370.1.58248 WP_000781370.1.58267 WP_000781370.1.58289 WP_000781370.1.58292 WP_000781370.1.58316 WP_000781370.1.58336 WP_000781370.1.58345 WP_000781370.1.58368 WP_000781370.1.58371 WP_000781370.1.58384 WP_000781370.1.58401 WP_000781370.1.58408 WP_000781370.1.58414 WP_000781370.1.5842 WP_000781370.1.58420 WP_000781370.1.58424 WP_000781370.1.58429 WP_000781370.1.58440 WP_000781370.1.58444 WP_000781370.1.58445 WP_000781370.1.58449 WP_000781370.1.58459 WP_000781370.1.58475 WP_000781370.1.58484 WP_000781370.1.58493 WP_000781370.1.58496 WP_000781370.1.585 WP_000781370.1.58507 WP_000781370.1.58514 WP_000781370.1.58528 WP_000781370.1.58547 WP_000781370.1.58552 WP_000781370.1.58560 WP_000781370.1.58572 WP_000781370.1.58582 WP_000781370.1.58609 WP_000781370.1.58617 WP_000781370.1.58622 WP_000781370.1.58657 WP_000781370.1.58680 WP_000781370.1.58692 WP_000781370.1.58705 WP_000781370.1.58737 WP_000781370.1.58799 WP_000781370.1.58837 WP_000781370.1.58867 WP_000781370.1.58870 WP_000781370.1.58901 WP_000781370.1.58940 WP_000781370.1.58942 WP_000781370.1.58951 WP_000781370.1.58958 WP_000781370.1.58976 WP_000781370.1.58977 WP_000781370.1.58983 WP_000781370.1.58999 WP_000781370.1.59024 WP_000781370.1.59026 WP_000781370.1.59035 WP_000781370.1.59047 WP_000781370.1.59055 WP_000781370.1.59060 WP_000781370.1.59073 WP_000781370.1.59083 WP_000781370.1.59119 WP_000781370.1.59174 WP_000781370.1.59190 WP_000781370.1.59199 WP_000781370.1.59218 WP_000781370.1.59263 WP_000781370.1.5927 WP_000781370.1.59280 WP_000781370.1.59291 WP_000781370.1.59292 WP_000781370.1.59293 WP_000781370.1.59302 WP_000781370.1.59306 WP_000781370.1.59395 WP_000781370.1.59396 WP_000781370.1.59407 WP_000781370.1.59409 WP_000781370.1.59413 WP_000781370.1.5942 WP_000781370.1.59423 WP_000781370.1.59425 WP_000781370.1.59426 WP_000781370.1.59434 WP_000781370.1.59483 WP_000781370.1.59513 WP_000781370.1.59553 WP_000781370.1.59572 WP_000781370.1.59577 WP_000781370.1.59579 WP_000781370.1.59590 WP_000781370.1.59611 WP_000781370.1.59613 WP_000781370.1.59615 WP_000781370.1.59621 WP_000781370.1.5963 WP_000781370.1.59638 WP_000781370.1.5965 WP_000781370.1.59660 WP_000781370.1.59689 WP_000781370.1.59699 WP_000781370.1.597 WP_000781370.1.59714 WP_000781370.1.59717 WP_000781370.1.59730 WP_000781370.1.59737 WP_000781370.1.59745 WP_000781370.1.59748 WP_000781370.1.59756 WP_000781370.1.59781 WP_000781370.1.59782 WP_000781370.1.59788 WP_000781370.1.59791 WP_000781370.1.59815 WP_000781370.1.59823 WP_000781370.1.59836 WP_000781370.1.59853 WP_000781370.1.59855 WP_000781370.1.59877 WP_000781370.1.59894 WP_000781370.1.5990 WP_000781370.1.59912 WP_000781370.1.59914 WP_000781370.1.59932 WP_000781370.1.59970 WP_000781370.1.59980 WP_000781370.1.59981 WP_000781370.1.59989 WP_000781370.1.59998 WP_000781370.1.60005 WP_000781370.1.6002 WP_000781370.1.60023 WP_000781370.1.60031 WP_000781370.1.60048 WP_000781370.1.60067 WP_000781370.1.60070 WP_000781370.1.60095 WP_000781370.1.60096 WP_000781370.1.60110 WP_000781370.1.60133 WP_000781370.1.60151 WP_000781370.1.60186 WP_000781370.1.6022 WP_000781370.1.60225 WP_000781370.1.60228 WP_000781370.1.60235 WP_000781370.1.60246 WP_000781370.1.60325 WP_000781370.1.60337 WP_000781370.1.60343 WP_000781370.1.60350 WP_000781370.1.60373 WP_000781370.1.60387 WP_000781370.1.60411 WP_000781370.1.60436 WP_000781370.1.60443 WP_000781370.1.60453 WP_000781370.1.60457 WP_000781370.1.60477 WP_000781370.1.60491 WP_000781370.1.60498 WP_000781370.1.60505 WP_000781370.1.60544 WP_000781370.1.60550 WP_000781370.1.60555 WP_000781370.1.60559 WP_000781370.1.60567 WP_000781370.1.60570 WP_000781370.1.60576 WP_000781370.1.6059 WP_000781370.1.60591 WP_000781370.1.60599 WP_000781370.1.60606 WP_000781370.1.6061 WP_000781370.1.60614 WP_000781370.1.60630 WP_000781370.1.6064 WP_000781370.1.60644 WP_000781370.1.60654 WP_000781370.1.6066 WP_000781370.1.60671 WP_000781370.1.6068 WP_000781370.1.60684 WP_000781370.1.60698 WP_000781370.1.60717 WP_000781370.1.60732 WP_000781370.1.60764 WP_000781370.1.60771 WP_000781370.1.60784 WP_000781370.1.60805 WP_000781370.1.60816 WP_000781370.1.60826 WP_000781370.1.60832 WP_000781370.1.60835 WP_000781370.1.60847 WP_000781370.1.60895 WP_000781370.1.60901 WP_000781370.1.60921 WP_000781370.1.60925 WP_000781370.1.60927 WP_000781370.1.6094 WP_000781370.1.60974 WP_000781370.1.61005 WP_000781370.1.61006 WP_000781370.1.61008 WP_000781370.1.61035 WP_000781370.1.61046 WP_000781370.1.61096 WP_000781370.1.6110 WP_000781370.1.61102 WP_000781370.1.61112 WP_000781370.1.61121 WP_000781370.1.61132 WP_000781370.1.61148 WP_000781370.1.61170 WP_000781370.1.61174 WP_000781370.1.61175 WP_000781370.1.61181 WP_000781370.1.61183 WP_000781370.1.61223 WP_000781370.1.61225 WP_000781370.1.61241 WP_000781370.1.61245 WP_000781370.1.61268 WP_000781370.1.61284 WP_000781370.1.61292 WP_000781370.1.613 WP_000781370.1.61360 WP_000781370.1.61362 WP_000781370.1.61364 WP_000781370.1.61373 WP_000781370.1.6138 WP_000781370.1.61398 WP_000781370.1.61442 WP_000781370.1.61445 WP_000781370.1.61480 WP_000781370.1.61496 WP_000781370.1.615 WP_000781370.1.61512 WP_000781370.1.61517 WP_000781370.1.61524 WP_000781370.1.61551 WP_000781370.1.61608 WP_000781370.1.61612 WP_000781370.1.61636 WP_000781370.1.61643 WP_000781370.1.61663 WP_000781370.1.61703 WP_000781370.1.61718 WP_000781370.1.61739 WP_000781370.1.61758 WP_000781370.1.61770 WP_000781370.1.61779 WP_000781370.1.61789 WP_000781370.1.61806 WP_000781370.1.61835 WP_000781370.1.61853 WP_000781370.1.61858 WP_000781370.1.61893 WP_000781370.1.61926 WP_000781370.1.61939 WP_000781370.1.61948 WP_000781370.1.61949 WP_000781370.1.61955 WP_000781370.1.61957 WP_000781370.1.61966 WP_000781370.1.61985 WP_000781370.1.62038 WP_000781370.1.62041 WP_000781370.1.62043 WP_000781370.1.62091 WP_000781370.1.62099 WP_000781370.1.62102 WP_000781370.1.6212 WP_000781370.1.62157 WP_000781370.1.62207 WP_000781370.1.62236 WP_000781370.1.62262 WP_000781370.1.62264 WP_000781370.1.62266 WP_000781370.1.62273 WP_000781370.1.62282 WP_000781370.1.62290 WP_000781370.1.62296 WP_000781370.1.62303 WP_000781370.1.62322 WP_000781370.1.62337 WP_000781370.1.62348 WP_000781370.1.62358 WP_000781370.1.62424 WP_000781370.1.62447 WP_000781370.1.6245 WP_000781370.1.62454 WP_000781370.1.62460 WP_000781370.1.62481 WP_000781370.1.62487 WP_000781370.1.62507 WP_000781370.1.62513 WP_000781370.1.62514 WP_000781370.1.62529 WP_000781370.1.62541 WP_000781370.1.62555 WP_000781370.1.62586 WP_000781370.1.62612 WP_000781370.1.62631 WP_000781370.1.62642 WP_000781370.1.62646 WP_000781370.1.62668 WP_000781370.1.62681 WP_000781370.1.62714 WP_000781370.1.62735 WP_000781370.1.62750 WP_000781370.1.62762 WP_000781370.1.62769 WP_000781370.1.62780 WP_000781370.1.62784 WP_000781370.1.62787 WP_000781370.1.62788 WP_000781370.1.62802 WP_000781370.1.62812 WP_000781370.1.62818 WP_000781370.1.62819 WP_000781370.1.6282 WP_000781370.1.62850 WP_000781370.1.62851 WP_000781370.1.62866 WP_000781370.1.62885 WP_000781370.1.62914 WP_000781370.1.62919 WP_000781370.1.6293 WP_000781370.1.62931 WP_000781370.1.62951 WP_000781370.1.62959 WP_000781370.1.62973 WP_000781370.1.62989 WP_000781370.1.6299 WP_000781370.1.62992 WP_000781370.1.63023 WP_000781370.1.6307 WP_000781370.1.63078 WP_000781370.1.63113 WP_000781370.1.63167 WP_000781370.1.63177 WP_000781370.1.63189 WP_000781370.1.6323 WP_000781370.1.63246 WP_000781370.1.63271 WP_000781370.1.63285 WP_000781370.1.63287 WP_000781370.1.63305 WP_000781370.1.63310 WP_000781370.1.63330 WP_000781370.1.6334 WP_000781370.1.63370 WP_000781370.1.63374 WP_000781370.1.63393 WP_000781370.1.63419 WP_000781370.1.63433 WP_000781370.1.63435 WP_000781370.1.63437 WP_000781370.1.63453 WP_000781370.1.63465 WP_000781370.1.63466 WP_000781370.1.63467 WP_000781370.1.63470 WP_000781370.1.63478 WP_000781370.1.6348 WP_000781370.1.63484 WP_000781370.1.63491 WP_000781370.1.63496 WP_000781370.1.63536 WP_000781370.1.63556 WP_000781370.1.63576 WP_000781370.1.63602 WP_000781370.1.63604 WP_000781370.1.63666 WP_000781370.1.63679 WP_000781370.1.63683 WP_000781370.1.63703 WP_000781370.1.63721 WP_000781370.1.63746 WP_000781370.1.63800 WP_000781370.1.63814 WP_000781370.1.63821 WP_000781370.1.63856 WP_000781370.1.63871 WP_000781370.1.63964 WP_000781370.1.63969 WP_000781370.1.63990 WP_000781370.1.64008 WP_000781370.1.64014 WP_000781370.1.64030 WP_000781370.1.64040 WP_000781370.1.64045 WP_000781370.1.64050 WP_000781370.1.64053 WP_000781370.1.64074 WP_000781370.1.64080 WP_000781370.1.64110 WP_000781370.1.64138 WP_000781370.1.64150 WP_000781370.1.6416 WP_000781370.1.64165 WP_000781370.1.64175 WP_000781370.1.64180 WP_000781370.1.64190 WP_000781370.1.64193 WP_000781370.1.64280 WP_000781370.1.64285 WP_000781370.1.64286 WP_000781370.1.643 WP_000781370.1.6431 WP_000781370.1.64312 WP_000781370.1.64321 WP_000781370.1.64330 WP_000781370.1.64337 WP_000781370.1.64353 WP_000781370.1.64355 WP_000781370.1.64356 WP_000781370.1.64380 WP_000781370.1.64391 WP_000781370.1.6441 WP_000781370.1.64417 WP_000781370.1.64437 WP_000781370.1.64438 WP_000781370.1.6444 WP_000781370.1.64448 WP_000781370.1.64458 WP_000781370.1.6446 WP_000781370.1.64519 WP_000781370.1.64520 WP_000781370.1.64528 WP_000781370.1.64540 WP_000781370.1.64547 WP_000781370.1.64563 WP_000781370.1.64634 WP_000781370.1.64657 WP_000781370.1.64670 WP_000781370.1.6469 WP_000781370.1.64693 WP_000781370.1.64695 WP_000781370.1.647 WP_000781370.1.64707 WP_000781370.1.64712 WP_000781370.1.64746 WP_000781370.1.64749 WP_000781370.1.64784 WP_000781370.1.64789 WP_000781370.1.64821 WP_000781370.1.64840 WP_000781370.1.64866 WP_000781370.1.64875 WP_000781370.1.64881 WP_000781370.1.64895 WP_000781370.1.64901 WP_000781370.1.64912 WP_000781370.1.64926 WP_000781370.1.64939 WP_000781370.1.64970 WP_000781370.1.6499 WP_000781370.1.64990 WP_000781370.1.6500 WP_000781370.1.65023 WP_000781370.1.65040 WP_000781370.1.65056 WP_000781370.1.65061 WP_000781370.1.65085 WP_000781370.1.651 WP_000781370.1.65104 WP_000781370.1.65110 WP_000781370.1.65114 WP_000781370.1.65116 WP_000781370.1.65122 WP_000781370.1.65135 WP_000781370.1.65151 WP_000781370.1.65155 WP_000781370.1.6516 WP_000781370.1.65179 WP_000781370.1.65192 WP_000781370.1.65206 WP_000781370.1.65240 WP_000781370.1.65256 WP_000781370.1.6527 WP_000781370.1.65271 WP_000781370.1.65286 WP_000781370.1.65296 WP_000781370.1.65305 WP_000781370.1.65306 WP_000781370.1.65353 WP_000781370.1.65355 WP_000781370.1.65364 WP_000781370.1.65366 WP_000781370.1.6537 WP_000781370.1.65370 WP_000781370.1.654 WP_000781370.1.65405 WP_000781370.1.65408 WP_000781370.1.65413 WP_000781370.1.65456 WP_000781370.1.65493 WP_000781370.1.6553 WP_000781370.1.65531 WP_000781370.1.65565 WP_000781370.1.65571 WP_000781370.1.65581 WP_000781370.1.65596 WP_000781370.1.65606 WP_000781370.1.6563 WP_000781370.1.65667 WP_000781370.1.65672 WP_000781370.1.65677 WP_000781370.1.65708 WP_000781370.1.65714 WP_000781370.1.65749 WP_000781370.1.6576 WP_000781370.1.65762 WP_000781370.1.65834 WP_000781370.1.65954 WP_000781370.1.65957 WP_000781370.1.65961 WP_000781370.1.65962 WP_000781370.1.65976 WP_000781370.1.6599 WP_000781370.1.66001 WP_000781370.1.66007 WP_000781370.1.66016 WP_000781370.1.66017 WP_000781370.1.66022 WP_000781370.1.6604 WP_000781370.1.66044 WP_000781370.1.66050 WP_000781370.1.66071 WP_000781370.1.6609 WP_000781370.1.66094 WP_000781370.1.66102 WP_000781370.1.66104 WP_000781370.1.66105 WP_000781370.1.66121 WP_000781370.1.66127 WP_000781370.1.66161 WP_000781370.1.6618 WP_000781370.1.66181 WP_000781370.1.66187 WP_000781370.1.66197 WP_000781370.1.6622 WP_000781370.1.66255 WP_000781370.1.66264 WP_000781370.1.66280 WP_000781370.1.66288 WP_000781370.1.66290 WP_000781370.1.66295 WP_000781370.1.66327 WP_000781370.1.66335 WP_000781370.1.6635 WP_000781370.1.66376 WP_000781370.1.66387 WP_000781370.1.66389 WP_000781370.1.66392 WP_000781370.1.66395 WP_000781370.1.66412 WP_000781370.1.66421 WP_000781370.1.66432 WP_000781370.1.66448 WP_000781370.1.6645 WP_000781370.1.66501 WP_000781370.1.66511 WP_000781370.1.66523 WP_000781370.1.6654 WP_000781370.1.66559 WP_000781370.1.66579 WP_000781370.1.66624 WP_000781370.1.66644 WP_000781370.1.6665 WP_000781370.1.6666 WP_000781370.1.66667 WP_000781370.1.66668 WP_000781370.1.66700 WP_000781370.1.66706 WP_000781370.1.66708 WP_000781370.1.66719 WP_000781370.1.66727 WP_000781370.1.66751 WP_000781370.1.66758 WP_000781370.1.6676 WP_000781370.1.66783 WP_000781370.1.66787 WP_000781370.1.66791 WP_000781370.1.66794 WP_000781370.1.66795 WP_000781370.1.66849 WP_000781370.1.66926 WP_000781370.1.66933 WP_000781370.1.66948 WP_000781370.1.66975 WP_000781370.1.6698 WP_000781370.1.66984 WP_000781370.1.67021 WP_000781370.1.67022 WP_000781370.1.67026 WP_000781370.1.67029 WP_000781370.1.67035 WP_000781370.1.67055 WP_000781370.1.6706 WP_000781370.1.67102 WP_000781370.1.67116 WP_000781370.1.67120 WP_000781370.1.67132 WP_000781370.1.67137 WP_000781370.1.67149 WP_000781370.1.67153 WP_000781370.1.67164 WP_000781370.1.67174 WP_000781370.1.67193 WP_000781370.1.67194 WP_000781370.1.67200 WP_000781370.1.67209 WP_000781370.1.67210 WP_000781370.1.6723 WP_000781370.1.67258 WP_000781370.1.67272 WP_000781370.1.67278 WP_000781370.1.67284 WP_000781370.1.67293 WP_000781370.1.6735 WP_000781370.1.67373 WP_000781370.1.67383 WP_000781370.1.67415 WP_000781370.1.67427 WP_000781370.1.67452 WP_000781370.1.67454 WP_000781370.1.67456 WP_000781370.1.67462 WP_000781370.1.67464 WP_000781370.1.67467 WP_000781370.1.67468 WP_000781370.1.67495 WP_000781370.1.67522 WP_000781370.1.67549 WP_000781370.1.67553 WP_000781370.1.67581 WP_000781370.1.67590 WP_000781370.1.67606 WP_000781370.1.67660 WP_000781370.1.67663 WP_000781370.1.67669 WP_000781370.1.67681 WP_000781370.1.67685 WP_000781370.1.67690 WP_000781370.1.67701 WP_000781370.1.67704 WP_000781370.1.67724 WP_000781370.1.67732 WP_000781370.1.67737 WP_000781370.1.67758 WP_000781370.1.67760 WP_000781370.1.67786 WP_000781370.1.67788 WP_000781370.1.678 WP_000781370.1.67841 WP_000781370.1.67853 WP_000781370.1.67861 WP_000781370.1.67891 WP_000781370.1.67894 WP_000781370.1.67901 WP_000781370.1.6793 WP_000781370.1.67938 WP_000781370.1.67971 WP_000781370.1.67975 WP_000781370.1.67984 WP_000781370.1.67990 WP_000781370.1.67992 WP_000781370.1.67999 WP_000781370.1.68008 WP_000781370.1.68011 WP_000781370.1.6802 WP_000781370.1.6803 WP_000781370.1.68039 WP_000781370.1.68052 WP_000781370.1.68053 WP_000781370.1.68058 WP_000781370.1.68059 WP_000781370.1.68063 WP_000781370.1.68067 WP_000781370.1.68069 WP_000781370.1.68070 WP_000781370.1.68071 WP_000781370.1.68079 WP_000781370.1.6810 WP_000781370.1.68108 WP_000781370.1.68126 WP_000781370.1.68138 WP_000781370.1.6814 WP_000781370.1.68145 WP_000781370.1.68157 WP_000781370.1.68170 WP_000781370.1.68175 WP_000781370.1.68177 WP_000781370.1.682 WP_000781370.1.68200 WP_000781370.1.68215 WP_000781370.1.68231 WP_000781370.1.68241 WP_000781370.1.68255 WP_000781370.1.68271 WP_000781370.1.68278 WP_000781370.1.68279 WP_000781370.1.68281 WP_000781370.1.68283 WP_000781370.1.68292 WP_000781370.1.68336 WP_000781370.1.68341 WP_000781370.1.68347 WP_000781370.1.68362 WP_000781370.1.68369 WP_000781370.1.68372 WP_000781370.1.68395 WP_000781370.1.68396 WP_000781370.1.68441 WP_000781370.1.68442 WP_000781370.1.68482 WP_000781370.1.68490 WP_000781370.1.68524 WP_000781370.1.68534 WP_000781370.1.68566 WP_000781370.1.68572 WP_000781370.1.68584 WP_000781370.1.6859 WP_000781370.1.68598 WP_000781370.1.6860 WP_000781370.1.68609 WP_000781370.1.68630 WP_000781370.1.68635 WP_000781370.1.68673 WP_000781370.1.68678 WP_000781370.1.68679 WP_000781370.1.68695 WP_000781370.1.68697 WP_000781370.1.68701 WP_000781370.1.68711 WP_000781370.1.68731 WP_000781370.1.68735 WP_000781370.1.68750 WP_000781370.1.68751 WP_000781370.1.68752 WP_000781370.1.68793 WP_000781370.1.68795 WP_000781370.1.68797 WP_000781370.1.68801 WP_000781370.1.68838 WP_000781370.1.68847 WP_000781370.1.68877 WP_000781370.1.68880 WP_000781370.1.68911 WP_000781370.1.68915 WP_000781370.1.68924 WP_000781370.1.68942 WP_000781370.1.68952 WP_000781370.1.68956 WP_000781370.1.68961 WP_000781370.1.68989 WP_000781370.1.68995 WP_000781370.1.69033 WP_000781370.1.69039 WP_000781370.1.69098 WP_000781370.1.69126 WP_000781370.1.69127 WP_000781370.1.69144 WP_000781370.1.69158 WP_000781370.1.6916 WP_000781370.1.69160 WP_000781370.1.6919 WP_000781370.1.69192 WP_000781370.1.6921 WP_000781370.1.69221 WP_000781370.1.6923 WP_000781370.1.69258 WP_000781370.1.69261 WP_000781370.1.6929 WP_000781370.1.69303 WP_000781370.1.69305 WP_000781370.1.69327 WP_000781370.1.69341 WP_000781370.1.69382 WP_000781370.1.69390 WP_000781370.1.694 WP_000781370.1.69438 WP_000781370.1.69441 WP_000781370.1.6945 WP_000781370.1.69450 WP_000781370.1.69472 WP_000781370.1.69473 WP_000781370.1.69502 WP_000781370.1.69506 WP_000781370.1.69537 WP_000781370.1.69551 WP_000781370.1.69569 WP_000781370.1.69583 WP_000781370.1.69589 WP_000781370.1.69593 WP_000781370.1.69596 WP_000781370.1.69605 WP_000781370.1.69643 WP_000781370.1.69646 WP_000781370.1.69649 WP_000781370.1.69655 WP_000781370.1.69689 WP_000781370.1.697 WP_000781370.1.69716 WP_000781370.1.69730 WP_000781370.1.69786 WP_000781370.1.69803 WP_000781370.1.69831 WP_000781370.1.69832 WP_000781370.1.69872 WP_000781370.1.69887 WP_000781370.1.6993 WP_000781370.1.69963 WP_000781370.1.69972 WP_000781370.1.69979 WP_000781370.1.69999 WP_000781370.1.7001 WP_000781370.1.70041 WP_000781370.1.70063 WP_000781370.1.70081 WP_000781370.1.701 WP_000781370.1.7013 WP_000781370.1.70149 WP_000781370.1.7015 WP_000781370.1.70190 WP_000781370.1.70213 WP_000781370.1.70230 WP_000781370.1.70264 WP_000781370.1.70299 WP_000781370.1.70300 WP_000781370.1.70337 WP_000781370.1.70357 WP_000781370.1.70370 WP_000781370.1.70386 WP_000781370.1.70407 WP_000781370.1.70408 WP_000781370.1.70414 WP_000781370.1.70477 WP_000781370.1.70492 WP_000781370.1.7050 WP_000781370.1.70509 WP_000781370.1.7052 WP_000781370.1.70530 WP_000781370.1.70563 WP_000781370.1.70578 WP_000781370.1.70582 WP_000781370.1.70592 WP_000781370.1.70597 WP_000781370.1.70600 WP_000781370.1.70628 WP_000781370.1.70655 WP_000781370.1.70656 WP_000781370.1.70686 WP_000781370.1.70694 WP_000781370.1.70698 WP_000781370.1.70728 WP_000781370.1.70745 WP_000781370.1.70747 WP_000781370.1.70748 WP_000781370.1.70767 WP_000781370.1.70794 WP_000781370.1.70801 WP_000781370.1.70803 WP_000781370.1.70880 WP_000781370.1.70896 WP_000781370.1.7090 WP_000781370.1.70900 WP_000781370.1.70952 WP_000781370.1.70967 WP_000781370.1.7102 WP_000781370.1.71024 WP_000781370.1.71037 WP_000781370.1.71042 WP_000781370.1.71062 WP_000781370.1.71109 WP_000781370.1.71113 WP_000781370.1.71139 WP_000781370.1.71144 WP_000781370.1.71147 WP_000781370.1.71149 WP_000781370.1.71159 WP_000781370.1.71162 WP_000781370.1.71170 WP_000781370.1.71176 WP_000781370.1.71183 WP_000781370.1.71192 WP_000781370.1.71199 WP_000781370.1.7121 WP_000781370.1.71221 WP_000781370.1.71223 WP_000781370.1.71264 WP_000781370.1.71272 WP_000781370.1.71273 WP_000781370.1.71275 WP_000781370.1.71285 WP_000781370.1.71287 WP_000781370.1.71294 WP_000781370.1.71311 WP_000781370.1.71312 WP_000781370.1.71315 WP_000781370.1.71323 WP_000781370.1.71327 WP_000781370.1.71339 WP_000781370.1.71354 WP_000781370.1.71397 WP_000781370.1.71403 WP_000781370.1.71405 WP_000781370.1.71409 WP_000781370.1.71421 WP_000781370.1.7147 WP_000781370.1.71480 WP_000781370.1.71522 WP_000781370.1.71533 WP_000781370.1.71537 WP_000781370.1.71538 WP_000781370.1.71540 WP_000781370.1.71560 WP_000781370.1.71562 WP_000781370.1.71563 WP_000781370.1.71603 WP_000781370.1.71607 WP_000781370.1.71632 WP_000781370.1.71680 WP_000781370.1.71690 WP_000781370.1.71732 WP_000781370.1.71757 WP_000781370.1.71767 WP_000781370.1.71783 WP_000781370.1.71830 WP_000781370.1.71832 WP_000781370.1.71837 WP_000781370.1.71855 WP_000781370.1.71856 WP_000781370.1.71874 WP_000781370.1.71912 WP_000781370.1.7192 WP_000781370.1.71922 WP_000781370.1.71938 WP_000781370.1.71939 WP_000781370.1.71944 WP_000781370.1.71945 WP_000781370.1.71967 WP_000781370.1.71972 WP_000781370.1.71975 WP_000781370.1.71987 WP_000781370.1.71993 WP_000781370.1.71995 WP_000781370.1.72013 WP_000781370.1.72021 WP_000781370.1.72028 WP_000781370.1.72033 WP_000781370.1.72048 WP_000781370.1.7205 WP_000781370.1.72053 WP_000781370.1.72054 WP_000781370.1.72066 WP_000781370.1.72090 WP_000781370.1.72098 WP_000781370.1.7210 WP_000781370.1.72117 WP_000781370.1.72120 WP_000781370.1.72125 WP_000781370.1.72126 WP_000781370.1.72141 WP_000781370.1.72153 WP_000781370.1.72155 WP_000781370.1.72157 WP_000781370.1.72161 WP_000781370.1.72162 WP_000781370.1.72186 WP_000781370.1.72208 WP_000781370.1.72212 WP_000781370.1.72237 WP_000781370.1.72240 WP_000781370.1.72248 WP_000781370.1.7225 WP_000781370.1.72258 WP_000781370.1.72261 WP_000781370.1.72262 WP_000781370.1.72270 WP_000781370.1.72279 WP_000781370.1.72293 WP_000781370.1.72298 WP_000781370.1.723 WP_000781370.1.72316 WP_000781370.1.72337 WP_000781370.1.72352 WP_000781370.1.72359 WP_000781370.1.72362 WP_000781370.1.72388 WP_000781370.1.72391 WP_000781370.1.72392 WP_000781370.1.72397 WP_000781370.1.72414 WP_000781370.1.72425 WP_000781370.1.72431 WP_000781370.1.72436 WP_000781370.1.72469 WP_000781370.1.72485 WP_000781370.1.72493 WP_000781370.1.72507 WP_000781370.1.72511 WP_000781370.1.72521 WP_000781370.1.72522 WP_000781370.1.72535 WP_000781370.1.72537 WP_000781370.1.72544 WP_000781370.1.72551 WP_000781370.1.72574 WP_000781370.1.72582 WP_000781370.1.72588 WP_000781370.1.72593 WP_000781370.1.72596 WP_000781370.1.72599 WP_000781370.1.72606 WP_000781370.1.72608 WP_000781370.1.72615 WP_000781370.1.72616 WP_000781370.1.72643 WP_000781370.1.72651 WP_000781370.1.72652 WP_000781370.1.72663 WP_000781370.1.72695 WP_000781370.1.72700 WP_000781370.1.72706 WP_000781370.1.72725 WP_000781370.1.72729 WP_000781370.1.72738 WP_000781370.1.72745 WP_000781370.1.72747 WP_000781370.1.72751 WP_000781370.1.72758 WP_000781370.1.72764 WP_000781370.1.7277 WP_000781370.1.72778 WP_000781370.1.72804 WP_000781370.1.72806 WP_000781370.1.7281 WP_000781370.1.72837 WP_000781370.1.72857 WP_000781370.1.72858 WP_000781370.1.72860 WP_000781370.1.72869 WP_000781370.1.72893 WP_000781370.1.72910 WP_000781370.1.72950 WP_000781370.1.72956 WP_000781370.1.72962 WP_000781370.1.72998 WP_000781370.1.73000 WP_000781370.1.73010 WP_000781370.1.73015 WP_000781370.1.73032 WP_000781370.1.73039 WP_000781370.1.73061 WP_000781370.1.7307 WP_000781370.1.73072 WP_000781370.1.73075 WP_000781370.1.73085 WP_000781370.1.7309 WP_000781370.1.73129 WP_000781370.1.73193 WP_000781370.1.73197 WP_000781370.1.73215 WP_000781370.1.73217 WP_000781370.1.73239 WP_000781370.1.73243 WP_000781370.1.73249 WP_000781370.1.73251 WP_000781370.1.73257 WP_000781370.1.73259 WP_000781370.1.73277 WP_000781370.1.73278 WP_000781370.1.73283 WP_000781370.1.73291 WP_000781370.1.73292 WP_000781370.1.73295 WP_000781370.1.73326 WP_000781370.1.73340 WP_000781370.1.73344 WP_000781370.1.73349 WP_000781370.1.73385 WP_000781370.1.73393 WP_000781370.1.73428 WP_000781370.1.73430 WP_000781370.1.7345 WP_000781370.1.73468 WP_000781370.1.73486 WP_000781370.1.7349 WP_000781370.1.73498 WP_000781370.1.73565 WP_000781370.1.73572 WP_000781370.1.73592 WP_000781370.1.73604 WP_000781370.1.73631 WP_000781370.1.73652 WP_000781370.1.73663 WP_000781370.1.73700 WP_000781370.1.73709 WP_000781370.1.73717 WP_000781370.1.73743 WP_000781370.1.73748 WP_000781370.1.7376 WP_000781370.1.73783 WP_000781370.1.73797 WP_000781370.1.73807 WP_000781370.1.73811 WP_000781370.1.73827 WP_000781370.1.73843 WP_000781370.1.73846 WP_000781370.1.73859 WP_000781370.1.73882 WP_000781370.1.73897 WP_000781370.1.73908 WP_000781370.1.73942 WP_000781370.1.73980 WP_000781370.1.73992 WP_000781370.1.73995 WP_000781370.1.73996 WP_000781370.1.74032 WP_000781370.1.74041 WP_000781370.1.74045 WP_000781370.1.74046 WP_000781370.1.74051 WP_000781370.1.74053 WP_000781370.1.7407 WP_000781370.1.7411 WP_000781370.1.74123 WP_000781370.1.74156 WP_000781370.1.74185 WP_000781370.1.74213 WP_000781370.1.74223 WP_000781370.1.7424 WP_000781370.1.74243 WP_000781370.1.7425 WP_000781370.1.74267 WP_000781370.1.74294 WP_000781370.1.74309 WP_000781370.1.74358 WP_000781370.1.74365 WP_000781370.1.74367 WP_000781370.1.744 WP_000781370.1.74423 WP_000781370.1.74426 WP_000781370.1.74431 WP_000781370.1.74444 WP_000781370.1.74465 WP_000781370.1.74478 WP_000781370.1.74491 WP_000781370.1.74501 WP_000781370.1.74513 WP_000781370.1.74520 WP_000781370.1.74528 WP_000781370.1.74532 WP_000781370.1.74549 WP_000781370.1.74574 WP_000781370.1.7461 WP_000781370.1.74611 WP_000781370.1.74623 WP_000781370.1.74625 WP_000781370.1.74631 WP_000781370.1.74652 WP_000781370.1.74670 WP_000781370.1.74682 WP_000781370.1.74687 WP_000781370.1.74688 WP_000781370.1.74689 WP_000781370.1.74691 WP_000781370.1.74705 WP_000781370.1.7471 WP_000781370.1.74713 WP_000781370.1.74716 WP_000781370.1.74735 WP_000781370.1.7475 WP_000781370.1.74752 WP_000781370.1.74765 WP_000781370.1.74767 WP_000781370.1.7478 WP_000781370.1.7479 WP_000781370.1.74793 WP_000781370.1.74811 WP_000781370.1.74844 WP_000781370.1.74852 WP_000781370.1.74854 WP_000781370.1.74860 WP_000781370.1.74867 WP_000781370.1.74873 WP_000781370.1.74879 WP_000781370.1.74880 WP_000781370.1.74885 WP_000781370.1.74889 WP_000781370.1.74895 WP_000781370.1.74914 WP_000781370.1.74915 WP_000781370.1.74962 WP_000781370.1.74975 WP_000781370.1.74993 WP_000781370.1.74998 WP_000781370.1.75021 WP_000781370.1.75029 WP_000781370.1.75050 WP_000781370.1.75087 WP_000781370.1.75100 WP_000781370.1.75112 WP_000781370.1.75118 WP_000781370.1.75136 WP_000781370.1.75138 WP_000781370.1.75139 WP_000781370.1.75143 WP_000781370.1.75145 WP_000781370.1.75149 WP_000781370.1.75155 WP_000781370.1.7516 WP_000781370.1.75181 WP_000781370.1.75209 WP_000781370.1.75218 WP_000781370.1.75219 WP_000781370.1.75221 WP_000781370.1.75243 WP_000781370.1.75247 WP_000781370.1.75254 WP_000781370.1.75270 WP_000781370.1.75306 WP_000781370.1.75360 WP_000781370.1.75419 WP_000781370.1.75428 WP_000781370.1.75435 WP_000781370.1.75465 WP_000781370.1.75491 WP_000781370.1.75515 WP_000781370.1.75529 WP_000781370.1.75537 WP_000781370.1.75568 WP_000781370.1.75588 WP_000781370.1.75594 WP_000781370.1.75602 WP_000781370.1.75612 WP_000781370.1.75629 WP_000781370.1.75644 WP_000781370.1.75653 WP_000781370.1.75676 WP_000781370.1.75679 WP_000781370.1.75687 WP_000781370.1.75696 WP_000781370.1.75698 WP_000781370.1.75699 WP_000781370.1.75725 WP_000781370.1.75735 WP_000781370.1.75758 WP_000781370.1.75786 WP_000781370.1.75803 WP_000781370.1.75808 WP_000781370.1.75839 WP_000781370.1.75853 WP_000781370.1.75892 WP_000781370.1.75918 WP_000781370.1.75922 WP_000781370.1.75973 WP_000781370.1.75995 WP_000781370.1.75999 WP_000781370.1.76005 WP_000781370.1.76009 WP_000781370.1.76019 WP_000781370.1.7603 WP_000781370.1.76030 WP_000781370.1.76036 WP_000781370.1.76039 WP_000781370.1.76057 WP_000781370.1.76087 WP_000781370.1.76089 WP_000781370.1.76103 WP_000781370.1.76118 WP_000781370.1.76119 WP_000781370.1.76129 WP_000781370.1.7613 WP_000781370.1.7617 WP_000781370.1.76184 WP_000781370.1.76194 WP_000781370.1.76196 WP_000781370.1.76211 WP_000781370.1.76237 WP_000781370.1.76268 WP_000781370.1.76269 WP_000781370.1.76305 WP_000781370.1.76312 WP_000781370.1.76325 WP_000781370.1.76335 WP_000781370.1.76361 WP_000781370.1.7637 WP_000781370.1.76376 WP_000781370.1.76384 WP_000781370.1.76387 WP_000781370.1.76390 WP_000781370.1.76446 WP_000781370.1.76452 WP_000781370.1.76462 WP_000781370.1.76466 WP_000781370.1.76469 WP_000781370.1.76504 WP_000781370.1.76542 WP_000781370.1.76544 WP_000781370.1.76562 WP_000781370.1.76595 WP_000781370.1.76596 WP_000781370.1.7661 WP_000781370.1.76612 WP_000781370.1.76619 WP_000781370.1.76656 WP_000781370.1.76660 WP_000781370.1.76701 WP_000781370.1.76705 WP_000781370.1.76707 WP_000781370.1.76712 WP_000781370.1.76751 WP_000781370.1.76759 WP_000781370.1.7680 WP_000781370.1.76815 WP_000781370.1.76831 WP_000781370.1.76840 WP_000781370.1.76863 WP_000781370.1.76884 WP_000781370.1.76909 WP_000781370.1.76918 WP_000781370.1.76933 WP_000781370.1.76948 WP_000781370.1.76961 WP_000781370.1.76965 WP_000781370.1.76966 WP_000781370.1.7699 WP_000781370.1.76994 WP_000781370.1.77015 WP_000781370.1.77022 WP_000781370.1.77036 WP_000781370.1.77042 WP_000781370.1.77057 WP_000781370.1.77070 WP_000781370.1.77081 WP_000781370.1.771 WP_000781370.1.77109 WP_000781370.1.77120 WP_000781370.1.77134 WP_000781370.1.77147 WP_000781370.1.77162 WP_000781370.1.77163 WP_000781370.1.77175 WP_000781370.1.77200 WP_000781370.1.77204 WP_000781370.1.77214 WP_000781370.1.77224 WP_000781370.1.77253 WP_000781370.1.77255 WP_000781370.1.77258 WP_000781370.1.7728 WP_000781370.1.77284 WP_000781370.1.77288 WP_000781370.1.7729 WP_000781370.1.77290 WP_000781370.1.77291 WP_000781370.1.77296 WP_000781370.1.7731 WP_000781370.1.77320 WP_000781370.1.77326 WP_000781370.1.77341 WP_000781370.1.77358 WP_000781370.1.77391 WP_000781370.1.77408 WP_000781370.1.77419 WP_000781370.1.77432 WP_000781370.1.77437 WP_000781370.1.77448 WP_000781370.1.77452 WP_000781370.1.77455 WP_000781370.1.77462 WP_000781370.1.7747 WP_000781370.1.77470 WP_000781370.1.77471 WP_000781370.1.77477 WP_000781370.1.77481 WP_000781370.1.77487 WP_000781370.1.77495 WP_000781370.1.775 WP_000781370.1.7750 WP_000781370.1.77503 WP_000781370.1.77511 WP_000781370.1.77542 WP_000781370.1.77551 WP_000781370.1.7756 WP_000781370.1.77577 WP_000781370.1.77581 WP_000781370.1.77595 WP_000781370.1.77600 WP_000781370.1.77608 WP_000781370.1.77626 WP_000781370.1.77632 WP_000781370.1.77636 WP_000781370.1.77643 WP_000781370.1.77648 WP_000781370.1.77657 WP_000781370.1.77725 WP_000781370.1.77741 WP_000781370.1.7775 WP_000781370.1.77767 WP_000781370.1.77768 WP_000781370.1.7780 WP_000781370.1.7781 WP_000781370.1.77816 WP_000781370.1.77826 WP_000781370.1.77833 WP_000781370.1.77876 WP_000781370.1.77929 WP_000781370.1.77949 WP_000781370.1.7795 WP_000781370.1.77950 WP_000781370.1.77999 WP_000781370.1.78000 WP_000781370.1.78007 WP_000781370.1.78010 WP_000781370.1.7804 WP_000781370.1.78059 WP_000781370.1.7806 WP_000781370.1.7808 WP_000781370.1.78089 WP_000781370.1.78097 WP_000781370.1.78099 WP_000781370.1.78101 WP_000781370.1.78102 WP_000781370.1.78131 WP_000781370.1.78183 WP_000781370.1.78187 WP_000781370.1.78188 WP_000781370.1.78196 WP_000781370.1.78202 WP_000781370.1.78232 WP_000781370.1.78233 WP_000781370.1.78235 WP_000781370.1.78305 WP_000781370.1.78321 WP_000781370.1.78323 WP_000781370.1.78337 WP_000781370.1.78340 WP_000781370.1.78368 WP_000781370.1.78376 WP_000781370.1.78390 WP_000781370.1.78413 WP_000781370.1.78445 WP_000781370.1.78453 WP_000781370.1.78462 WP_000781370.1.78463 WP_000781370.1.7847 WP_000781370.1.78477 WP_000781370.1.78481 WP_000781370.1.78491 WP_000781370.1.7851 WP_000781370.1.78512 WP_000781370.1.78515 WP_000781370.1.78523 WP_000781370.1.78527 WP_000781370.1.78553 WP_000781370.1.78572 WP_000781370.1.78575 WP_000781370.1.78581 WP_000781370.1.78583 WP_000781370.1.78586 WP_000781370.1.78610 WP_000781370.1.78612 WP_000781370.1.78615 WP_000781370.1.78622 WP_000781370.1.78645 WP_000781370.1.78677 WP_000781370.1.78683 WP_000781370.1.78687 WP_000781370.1.78689 WP_000781370.1.78696 WP_000781370.1.78698 WP_000781370.1.78706 WP_000781370.1.78714 WP_000781370.1.78718 WP_000781370.1.78746 WP_000781370.1.78750 WP_000781370.1.78757 WP_000781370.1.78773 WP_000781370.1.78775 WP_000781370.1.78791 WP_000781370.1.78814 WP_000781370.1.7883 WP_000781370.1.78843 WP_000781370.1.78845 WP_000781370.1.78854 WP_000781370.1.78888 WP_000781370.1.78891 WP_000781370.1.78893 WP_000781370.1.78895 WP_000781370.1.78908 WP_000781370.1.78919 WP_000781370.1.78953 WP_000781370.1.78955 WP_000781370.1.78956 WP_000781370.1.7896 WP_000781370.1.78966 WP_000781370.1.7898 WP_000781370.1.78996 WP_000781370.1.79001 WP_000781370.1.79002 WP_000781370.1.79004 WP_000781370.1.7901 WP_000781370.1.79065 WP_000781370.1.79067 WP_000781370.1.79075 WP_000781370.1.79086 WP_000781370.1.79088 WP_000781370.1.79090 WP_000781370.1.79092 WP_000781370.1.79100 WP_000781370.1.79126 WP_000781370.1.79137 WP_000781370.1.79159 WP_000781370.1.79226 WP_000781370.1.79233 WP_000781370.1.79243 WP_000781370.1.79248 WP_000781370.1.79249 WP_000781370.1.79276 WP_000781370.1.79306 WP_000781370.1.79308 WP_000781370.1.79312 WP_000781370.1.79343 WP_000781370.1.79346 WP_000781370.1.79356 WP_000781370.1.79365 WP_000781370.1.79368 WP_000781370.1.79369 WP_000781370.1.7937 WP_000781370.1.79389 WP_000781370.1.79391 WP_000781370.1.79409 WP_000781370.1.79414 WP_000781370.1.79416 WP_000781370.1.79443 WP_000781370.1.79464 WP_000781370.1.79505 WP_000781370.1.7952 WP_000781370.1.79525 WP_000781370.1.79526 WP_000781370.1.79540 WP_000781370.1.79558 WP_000781370.1.79591 WP_000781370.1.79606 WP_000781370.1.79619 WP_000781370.1.79640 WP_000781370.1.79685 WP_000781370.1.79707 WP_000781370.1.79713 WP_000781370.1.79759 WP_000781370.1.79764 WP_000781370.1.79800 WP_000781370.1.79816 WP_000781370.1.79824 WP_000781370.1.79840 WP_000781370.1.7985 WP_000781370.1.79869 WP_000781370.1.7987 WP_000781370.1.79871 WP_000781370.1.79877 WP_000781370.1.79905 WP_000781370.1.79922 WP_000781370.1.7993 WP_000781370.1.79930 WP_000781370.1.79931 WP_000781370.1.79932 WP_000781370.1.79933 WP_000781370.1.79936 WP_000781370.1.79944 WP_000781370.1.79952 WP_000781370.1.79955 WP_000781370.1.79973 WP_000781370.1.79984 WP_000781370.1.80 WP_000781370.1.80011 WP_000781370.1.80016 WP_000781370.1.80026 WP_000781370.1.8004 WP_000781370.1.80043 WP_000781370.1.80050 WP_000781370.1.80060 WP_000781370.1.80063 WP_000781370.1.8007 WP_000781370.1.80071 WP_000781370.1.80096 WP_000781370.1.80106 WP_000781370.1.8011 WP_000781370.1.80112 WP_000781370.1.80141 WP_000781370.1.80168 WP_000781370.1.80176 WP_000781370.1.80179 WP_000781370.1.80183 WP_000781370.1.80192 WP_000781370.1.80255 WP_000781370.1.80292 WP_000781370.1.80310 WP_000781370.1.80320 WP_000781370.1.80343 WP_000781370.1.80388 WP_000781370.1.80392 WP_000781370.1.804 WP_000781370.1.80426 WP_000781370.1.80428 WP_000781370.1.80440 WP_000781370.1.80444 WP_000781370.1.80456 WP_000781370.1.80484 WP_000781370.1.80517 WP_000781370.1.80519 WP_000781370.1.80524 WP_000781370.1.80545 WP_000781370.1.80558 WP_000781370.1.80559 WP_000781370.1.8057 WP_000781370.1.80577 WP_000781370.1.80594 WP_000781370.1.80612 WP_000781370.1.80626 WP_000781370.1.80660 WP_000781370.1.80662 WP_000781370.1.80666 WP_000781370.1.80676 WP_000781370.1.8068 WP_000781370.1.80709 WP_000781370.1.80718 WP_000781370.1.80724 WP_000781370.1.80731 WP_000781370.1.80736 WP_000781370.1.80737 WP_000781370.1.8074 WP_000781370.1.80753 WP_000781370.1.80754 WP_000781370.1.80756 WP_000781370.1.8076 WP_000781370.1.80768 WP_000781370.1.80789 WP_000781370.1.808 WP_000781370.1.80804 WP_000781370.1.80805 WP_000781370.1.80843 WP_000781370.1.80862 WP_000781370.1.80882 WP_000781370.1.80884 WP_000781370.1.80894 WP_000781370.1.8090 WP_000781370.1.8091 WP_000781370.1.80935 WP_000781370.1.80945 WP_000781370.1.80946 WP_000781370.1.80948 WP_000781370.1.80954 WP_000781370.1.80983 WP_000781370.1.80985 WP_000781370.1.810 WP_000781370.1.81026 WP_000781370.1.81032 WP_000781370.1.81034 WP_000781370.1.81036 WP_000781370.1.81054 WP_000781370.1.81056 WP_000781370.1.81071 WP_000781370.1.81098 WP_000781370.1.811 WP_000781370.1.81104 WP_000781370.1.81120 WP_000781370.1.81127 WP_000781370.1.81141 WP_000781370.1.81156 WP_000781370.1.81165 WP_000781370.1.8118 WP_000781370.1.81180 WP_000781370.1.81182 WP_000781370.1.81186 WP_000781370.1.8121 WP_000781370.1.81266 WP_000781370.1.81267 WP_000781370.1.81281 WP_000781370.1.81283 WP_000781370.1.81286 WP_000781370.1.8129 WP_000781370.1.81298 WP_000781370.1.81313 WP_000781370.1.81316 WP_000781370.1.81323 WP_000781370.1.81347 WP_000781370.1.81376 WP_000781370.1.81391 WP_000781370.1.814 WP_000781370.1.81418 WP_000781370.1.81423 WP_000781370.1.81438 WP_000781370.1.81469 WP_000781370.1.81475 WP_000781370.1.81484 WP_000781370.1.8156 WP_000781370.1.81576 WP_000781370.1.81577 WP_000781370.1.81580 WP_000781370.1.81588 WP_000781370.1.81589 WP_000781370.1.81596 WP_000781370.1.81602 WP_000781370.1.81618 WP_000781370.1.81624 WP_000781370.1.81625 WP_000781370.1.81688 WP_000781370.1.81692 WP_000781370.1.81715 WP_000781370.1.8172 WP_000781370.1.81723 WP_000781370.1.81739 WP_000781370.1.81761 WP_000781370.1.81819 WP_000781370.1.8183 WP_000781370.1.81832 WP_000781370.1.81843 WP_000781370.1.81869 WP_000781370.1.81881 WP_000781370.1.81888 WP_000781370.1.81914 WP_000781370.1.81935 WP_000781370.1.81939 WP_000781370.1.81952 WP_000781370.1.81972 WP_000781370.1.82 WP_000781370.1.82008 WP_000781370.1.82032 WP_000781370.1.82059 WP_000781370.1.82061 WP_000781370.1.82062 WP_000781370.1.82074 WP_000781370.1.82095 WP_000781370.1.82104 WP_000781370.1.82106 WP_000781370.1.82116 WP_000781370.1.82123 WP_000781370.1.82137 WP_000781370.1.82166 WP_000781370.1.82217 WP_000781370.1.82221 WP_000781370.1.82239 WP_000781370.1.82240 WP_000781370.1.82242 WP_000781370.1.82246 WP_000781370.1.82275 WP_000781370.1.82280 WP_000781370.1.82316 WP_000781370.1.82320 WP_000781370.1.82326 WP_000781370.1.82330 WP_000781370.1.8235 WP_000781370.1.82378 WP_000781370.1.82438 WP_000781370.1.82439 WP_000781370.1.82485 WP_000781370.1.82499 WP_000781370.1.82514 WP_000781370.1.82527 WP_000781370.1.82536 WP_000781370.1.82539 WP_000781370.1.8255 WP_000781370.1.82572 WP_000781370.1.82589 WP_000781370.1.82614 WP_000781370.1.82626 WP_000781370.1.82661 WP_000781370.1.82691 WP_000781370.1.82698 WP_000781370.1.82700 WP_000781370.1.82705 WP_000781370.1.82711 WP_000781370.1.82715 WP_000781370.1.82718 WP_000781370.1.82747 WP_000781370.1.82754 WP_000781370.1.8277 WP_000781370.1.82776 WP_000781370.1.82780 WP_000781370.1.82784 WP_000781370.1.82799 WP_000781370.1.82808 WP_000781370.1.82816 WP_000781370.1.82831 WP_000781370.1.82833 WP_000781370.1.82853 WP_000781370.1.82901 WP_000781370.1.82902 WP_000781370.1.82923 WP_000781370.1.8295 WP_000781370.1.82991 WP_000781370.1.83020 WP_000781370.1.83033 WP_000781370.1.83035 WP_000781370.1.83036 WP_000781370.1.83051 WP_000781370.1.83059 WP_000781370.1.8306 WP_000781370.1.8308 WP_000781370.1.83093 WP_000781370.1.83097 WP_000781370.1.831 WP_000781370.1.83118 WP_000781370.1.83125 WP_000781370.1.83127 WP_000781370.1.83140 WP_000781370.1.83144 WP_000781370.1.83160 WP_000781370.1.83177 WP_000781370.1.83205 WP_000781370.1.83214 WP_000781370.1.83218 WP_000781370.1.83224 WP_000781370.1.83238 WP_000781370.1.83256 WP_000781370.1.83313 WP_000781370.1.83330 WP_000781370.1.83347 WP_000781370.1.83375 WP_000781370.1.83384 WP_000781370.1.83415 WP_000781370.1.8345 WP_000781370.1.83466 WP_000781370.1.83481 WP_000781370.1.83506 WP_000781370.1.83537 WP_000781370.1.83544 WP_000781370.1.83564 WP_000781370.1.83582 WP_000781370.1.83584 WP_000781370.1.83644 WP_000781370.1.83660 WP_000781370.1.83668 WP_000781370.1.8368 WP_000781370.1.83684 WP_000781370.1.83706 WP_000781370.1.83735 WP_000781370.1.83762 WP_000781370.1.83807 WP_000781370.1.83820 WP_000781370.1.8384 WP_000781370.1.8386 WP_000781370.1.83879 WP_000781370.1.83911 WP_000781370.1.83936 WP_000781370.1.83941 WP_000781370.1.83947 WP_000781370.1.84004 WP_000781370.1.84014 WP_000781370.1.84021 WP_000781370.1.8405 WP_000781370.1.84060 WP_000781370.1.84074 WP_000781370.1.8408 WP_000781370.1.8411 WP_000781370.1.84140 WP_000781370.1.84172 WP_000781370.1.84185 WP_000781370.1.84197 WP_000781370.1.84210 WP_000781370.1.84215 WP_000781370.1.84221 WP_000781370.1.84298 WP_000781370.1.84313 WP_000781370.1.84316 WP_000781370.1.84319 WP_000781370.1.84326 WP_000781370.1.84331 WP_000781370.1.84339 WP_000781370.1.84348 WP_000781370.1.84402 WP_000781370.1.84405 WP_000781370.1.84410 WP_000781370.1.84436 WP_000781370.1.8444 WP_000781370.1.84462 WP_000781370.1.84464 WP_000781370.1.84467 WP_000781370.1.8447 WP_000781370.1.84473 WP_000781370.1.84476 WP_000781370.1.84484 WP_000781370.1.84486 WP_000781370.1.84511 WP_000781370.1.84518 WP_000781370.1.84531 WP_000781370.1.84534 WP_000781370.1.84584 WP_000781370.1.84639 WP_000781370.1.84656 WP_000781370.1.84668 WP_000781370.1.84675 WP_000781370.1.84697 WP_000781370.1.84731 WP_000781370.1.84738 WP_000781370.1.84740 WP_000781370.1.84768 WP_000781370.1.84841 WP_000781370.1.84850 WP_000781370.1.84875 WP_000781370.1.84877 WP_000781370.1.84878 WP_000781370.1.84881 WP_000781370.1.84893 WP_000781370.1.84894 WP_000781370.1.84916 WP_000781370.1.84929 WP_000781370.1.84948 WP_000781370.1.84966 WP_000781370.1.84972 WP_000781370.1.84989 WP_000781370.1.84994 WP_000781370.1.85002 WP_000781370.1.85011 WP_000781370.1.85025 WP_000781370.1.85048 WP_000781370.1.85052 WP_000781370.1.85077 WP_000781370.1.85085 WP_000781370.1.85090 WP_000781370.1.85098 WP_000781370.1.85105 WP_000781370.1.85106 WP_000781370.1.85112 WP_000781370.1.85125 WP_000781370.1.85129 WP_000781370.1.85138 WP_000781370.1.85141 WP_000781370.1.85155 WP_000781370.1.85156 WP_000781370.1.8517 WP_000781370.1.85175 WP_000781370.1.85188 WP_000781370.1.85216 WP_000781370.1.85241 WP_000781370.1.85247 WP_000781370.1.85252 WP_000781370.1.85260 WP_000781370.1.8530 WP_000781370.1.85305 WP_000781370.1.85310 WP_000781370.1.85315 WP_000781370.1.85320 WP_000781370.1.85323 WP_000781370.1.85329 WP_000781370.1.85335 WP_000781370.1.85336 WP_000781370.1.85342 WP_000781370.1.85361 WP_000781370.1.85369 WP_000781370.1.85384 WP_000781370.1.85385 WP_000781370.1.85435 WP_000781370.1.85500 WP_000781370.1.85504 WP_000781370.1.85525 WP_000781370.1.85546 WP_000781370.1.85554 WP_000781370.1.85556 WP_000781370.1.85563 WP_000781370.1.85578 WP_000781370.1.85593 WP_000781370.1.8560 WP_000781370.1.85601 WP_000781370.1.85621 WP_000781370.1.85623 WP_000781370.1.8564 WP_000781370.1.85657 WP_000781370.1.85685 WP_000781370.1.85752 WP_000781370.1.85767 WP_000781370.1.85773 WP_000781370.1.85781 WP_000781370.1.8579 WP_000781370.1.85793 WP_000781370.1.85800 WP_000781370.1.85806 WP_000781370.1.8582 WP_000781370.1.85857 WP_000781370.1.85895 WP_000781370.1.85939 WP_000781370.1.85944 WP_000781370.1.85948 WP_000781370.1.86 WP_000781370.1.86001 WP_000781370.1.86016 WP_000781370.1.8603 WP_000781370.1.86035 WP_000781370.1.86063 WP_000781370.1.8607 WP_000781370.1.86104 WP_000781370.1.86110 WP_000781370.1.86115 WP_000781370.1.86145 WP_000781370.1.86149 WP_000781370.1.86161 WP_000781370.1.86166 WP_000781370.1.86176 WP_000781370.1.86179 WP_000781370.1.86181 WP_000781370.1.86189 WP_000781370.1.86196 WP_000781370.1.8621 WP_000781370.1.86210 WP_000781370.1.86227 WP_000781370.1.86228 WP_000781370.1.86234 WP_000781370.1.86263 WP_000781370.1.86266 WP_000781370.1.86273 WP_000781370.1.86276 WP_000781370.1.86280 WP_000781370.1.86283 WP_000781370.1.86294 WP_000781370.1.86307 WP_000781370.1.8635 WP_000781370.1.86353 WP_000781370.1.86355 WP_000781370.1.86364 WP_000781370.1.86371 WP_000781370.1.86376 WP_000781370.1.86393 WP_000781370.1.86411 WP_000781370.1.86412 WP_000781370.1.86451 WP_000781370.1.86452 WP_000781370.1.86454 WP_000781370.1.86461 WP_000781370.1.86475 WP_000781370.1.86492 WP_000781370.1.86518 WP_000781370.1.8652 WP_000781370.1.8656 WP_000781370.1.86560 WP_000781370.1.86586 WP_000781370.1.86598 WP_000781370.1.86609 WP_000781370.1.86613 WP_000781370.1.86617 WP_000781370.1.86627 WP_000781370.1.86640 WP_000781370.1.86667 WP_000781370.1.86673 WP_000781370.1.86674 WP_000781370.1.86691 WP_000781370.1.86707 WP_000781370.1.86717 WP_000781370.1.86727 WP_000781370.1.86731 WP_000781370.1.86734 WP_000781370.1.86753 WP_000781370.1.86760 WP_000781370.1.86768 WP_000781370.1.86787 WP_000781370.1.86788 WP_000781370.1.8679 WP_000781370.1.86833 WP_000781370.1.86846 WP_000781370.1.8687 WP_000781370.1.86934 WP_000781370.1.86935 WP_000781370.1.86956 WP_000781370.1.86959 WP_000781370.1.86975 WP_000781370.1.86997 WP_000781370.1.87043 WP_000781370.1.8705 WP_000781370.1.87059 WP_000781370.1.87067 WP_000781370.1.87075 WP_000781370.1.87102 WP_000781370.1.87109 WP_000781370.1.8711 WP_000781370.1.87177 WP_000781370.1.87205 WP_000781370.1.87249 WP_000781370.1.87310 WP_000781370.1.87339 WP_000781370.1.87358 WP_000781370.1.87371 WP_000781370.1.87389 WP_000781370.1.87400 WP_000781370.1.87410 WP_000781370.1.87443 WP_000781370.1.87465 WP_000781370.1.87491 WP_000781370.1.87504 WP_000781370.1.87557 WP_000781370.1.87563 WP_000781370.1.87568 WP_000781370.1.87574 WP_000781370.1.87581 WP_000781370.1.87590 WP_000781370.1.87607 WP_000781370.1.87608 WP_000781370.1.87610 WP_000781370.1.87633 WP_000781370.1.87635 WP_000781370.1.87639 WP_000781370.1.87655 WP_000781370.1.87675 WP_000781370.1.87694 WP_000781370.1.87696 WP_000781370.1.8771 WP_000781370.1.87721 WP_000781370.1.87726 WP_000781370.1.87728 WP_000781370.1.87738 WP_000781370.1.87766 WP_000781370.1.8778 WP_000781370.1.87786 WP_000781370.1.87788 WP_000781370.1.87789 WP_000781370.1.87822 WP_000781370.1.87834 WP_000781370.1.87857 WP_000781370.1.87883 WP_000781370.1.87914 WP_000781370.1.87919 WP_000781370.1.87973 WP_000781370.1.87976 WP_000781370.1.87980 WP_000781370.1.87984 WP_000781370.1.87989 WP_000781370.1.880 WP_000781370.1.88017 WP_000781370.1.88020 WP_000781370.1.88066 WP_000781370.1.8807 WP_000781370.1.88082 WP_000781370.1.88088 WP_000781370.1.88110 WP_000781370.1.88119 WP_000781370.1.88189 WP_000781370.1.8822 WP_000781370.1.88234 WP_000781370.1.88238 WP_000781370.1.88252 WP_000781370.1.88260 WP_000781370.1.88285 WP_000781370.1.88301 WP_000781370.1.88304 WP_000781370.1.88336 WP_000781370.1.88352 WP_000781370.1.88376 WP_000781370.1.88379 WP_000781370.1.88384 WP_000781370.1.88413 WP_000781370.1.88427 WP_000781370.1.88434 WP_000781370.1.88438 WP_000781370.1.88462 WP_000781370.1.88467 WP_000781370.1.8848 WP_000781370.1.88499 WP_000781370.1.88505 WP_000781370.1.88527 WP_000781370.1.88535 WP_000781370.1.88539 WP_000781370.1.8854 WP_000781370.1.8855 WP_000781370.1.88557 WP_000781370.1.88562 WP_000781370.1.88577 WP_000781370.1.88598 WP_000781370.1.88603 WP_000781370.1.88607 WP_000781370.1.88631 WP_000781370.1.88646 WP_000781370.1.88667 WP_000781370.1.88678 WP_000781370.1.88685 WP_000781370.1.88686 WP_000781370.1.88709 WP_000781370.1.88710 WP_000781370.1.88711 WP_000781370.1.88717 WP_000781370.1.88720 WP_000781370.1.88729 WP_000781370.1.8873 WP_000781370.1.88732 WP_000781370.1.88752 WP_000781370.1.88757 WP_000781370.1.88759 WP_000781370.1.88767 WP_000781370.1.8879 WP_000781370.1.88793 WP_000781370.1.88826 WP_000781370.1.88834 WP_000781370.1.88864 WP_000781370.1.88880 WP_000781370.1.88883 WP_000781370.1.88941 WP_000781370.1.88950 WP_000781370.1.88953 WP_000781370.1.88961 WP_000781370.1.88997 WP_000781370.1.89018 WP_000781370.1.89043 WP_000781370.1.89050 WP_000781370.1.8906 WP_000781370.1.89067 WP_000781370.1.89069 WP_000781370.1.89090 WP_000781370.1.89097 WP_000781370.1.89099 WP_000781370.1.89111 WP_000781370.1.89150 WP_000781370.1.89163 WP_000781370.1.89165 WP_000781370.1.89183 WP_000781370.1.89197 WP_000781370.1.89200 WP_000781370.1.89203 WP_000781370.1.89214 WP_000781370.1.89217 WP_000781370.1.89255 WP_000781370.1.8928 WP_000781370.1.89285 WP_000781370.1.89305 WP_000781370.1.89312 WP_000781370.1.89334 WP_000781370.1.89335 WP_000781370.1.89351 WP_000781370.1.89379 WP_000781370.1.8938 WP_000781370.1.89396 WP_000781370.1.894 WP_000781370.1.89400 WP_000781370.1.89403 WP_000781370.1.89416 WP_000781370.1.89427 WP_000781370.1.89432 WP_000781370.1.8945 WP_000781370.1.89455 WP_000781370.1.89458 WP_000781370.1.89466 WP_000781370.1.89468 WP_000781370.1.89469 WP_000781370.1.89471 WP_000781370.1.89474 WP_000781370.1.89479 WP_000781370.1.89492 WP_000781370.1.89496 WP_000781370.1.89510 WP_000781370.1.89551 WP_000781370.1.89583 WP_000781370.1.89601 WP_000781370.1.89605 WP_000781370.1.89627 WP_000781370.1.89631 WP_000781370.1.89646 WP_000781370.1.89656 WP_000781370.1.89674 WP_000781370.1.89679 WP_000781370.1.89700 WP_000781370.1.89710 WP_000781370.1.89745 WP_000781370.1.89747 WP_000781370.1.89768 WP_000781370.1.89788 WP_000781370.1.89818 WP_000781370.1.89839 WP_000781370.1.89841 WP_000781370.1.89879 WP_000781370.1.89895 WP_000781370.1.89899 WP_000781370.1.89915 WP_000781370.1.89917 WP_000781370.1.89918 WP_000781370.1.89920 WP_000781370.1.89925 WP_000781370.1.89927 WP_000781370.1.89977 WP_000781370.1.90017 WP_000781370.1.90022 WP_000781370.1.90050 WP_000781370.1.90063 WP_000781370.1.90078 WP_000781370.1.9009 WP_000781370.1.9010 WP_000781370.1.90115 WP_000781370.1.90128 WP_000781370.1.90146 WP_000781370.1.90156 WP_000781370.1.90168 WP_000781370.1.90171 WP_000781370.1.90182 WP_000781370.1.902 WP_000781370.1.90205 WP_000781370.1.90249 WP_000781370.1.90256 WP_000781370.1.90266 WP_000781370.1.90270 WP_000781370.1.90315 WP_000781370.1.90332 WP_000781370.1.90357 WP_000781370.1.90358 WP_000781370.1.9036 WP_000781370.1.9037 WP_000781370.1.90389 WP_000781370.1.90405 WP_000781370.1.90435 WP_000781370.1.90436 WP_000781370.1.90441 WP_000781370.1.90449 WP_000781370.1.90467 WP_000781370.1.90511 WP_000781370.1.90525 WP_000781370.1.90536 WP_000781370.1.90542 WP_000781370.1.90547 WP_000781370.1.9059 WP_000781370.1.90591 WP_000781370.1.90602 WP_000781370.1.9061 WP_000781370.1.90626 WP_000781370.1.90703 WP_000781370.1.90758 WP_000781370.1.90775 WP_000781370.1.90799 WP_000781370.1.9081 WP_000781370.1.90813 WP_000781370.1.90822 WP_000781370.1.90828 WP_000781370.1.90834 WP_000781370.1.90839 WP_000781370.1.9084 WP_000781370.1.90844 WP_000781370.1.90856 WP_000781370.1.90864 WP_000781370.1.90865 WP_000781370.1.9087 WP_000781370.1.90873 WP_000781370.1.90890 WP_000781370.1.909 WP_000781370.1.90905 WP_000781370.1.90924 WP_000781370.1.90951 WP_000781370.1.90960 WP_000781370.1.90979 WP_000781370.1.90988 WP_000781370.1.90996 WP_000781370.1.91 WP_000781370.1.91007 WP_000781370.1.91010 WP_000781370.1.9104 WP_000781370.1.91094 WP_000781370.1.91113 WP_000781370.1.91117 WP_000781370.1.91121 WP_000781370.1.91138 WP_000781370.1.91143 WP_000781370.1.91170 WP_000781370.1.9118 WP_000781370.1.9119 WP_000781370.1.91213 WP_000781370.1.91220 WP_000781370.1.91266 WP_000781370.1.91268 WP_000781370.1.91277 WP_000781370.1.91290 WP_000781370.1.91340 WP_000781370.1.91341 WP_000781370.1.91354 WP_000781370.1.91361 WP_000781370.1.91377 WP_000781370.1.91397 WP_000781370.1.91414 WP_000781370.1.91425 WP_000781370.1.91445 WP_000781370.1.91462 WP_000781370.1.91482 WP_000781370.1.91485 WP_000781370.1.91494 WP_000781370.1.915 WP_000781370.1.91515 WP_000781370.1.91526 WP_000781370.1.91543 WP_000781370.1.91549 WP_000781370.1.91551 WP_000781370.1.91565 WP_000781370.1.91566 WP_000781370.1.9157 WP_000781370.1.91594 WP_000781370.1.91596 WP_000781370.1.9160 WP_000781370.1.91626 WP_000781370.1.91630 WP_000781370.1.91640 WP_000781370.1.91643 WP_000781370.1.91644 WP_000781370.1.91666 WP_000781370.1.91672 WP_000781370.1.91685 WP_000781370.1.9169 WP_000781370.1.91701 WP_000781370.1.9171 WP_000781370.1.91739 WP_000781370.1.91756 WP_000781370.1.91777 WP_000781370.1.91779 WP_000781370.1.91782 WP_000781370.1.91787 WP_000781370.1.91793 WP_000781370.1.91814 WP_000781370.1.91843 WP_000781370.1.9185 WP_000781370.1.91850 WP_000781370.1.91863 WP_000781370.1.91879 WP_000781370.1.91887 WP_000781370.1.91893 WP_000781370.1.91951 WP_000781370.1.91954 WP_000781370.1.91959 WP_000781370.1.91971 WP_000781370.1.9199 WP_000781370.1.91994 WP_000781370.1.92005 WP_000781370.1.92014 WP_000781370.1.92019 WP_000781370.1.92025 WP_000781370.1.92029 WP_000781370.1.92031 WP_000781370.1.92048 WP_000781370.1.92053 WP_000781370.1.92058 WP_000781370.1.9209 WP_000781370.1.92096 WP_000781370.1.921 WP_000781370.1.92102 WP_000781370.1.92114 WP_000781370.1.9215 WP_000781370.1.92161 WP_000781370.1.92163 WP_000781370.1.92180 WP_000781370.1.92195 WP_000781370.1.92201 WP_000781370.1.92215 WP_000781370.1.92224 WP_000781370.1.92276 WP_000781370.1.92295 WP_000781370.1.92304 WP_000781370.1.92305 WP_000781370.1.92311 WP_000781370.1.92323 WP_000781370.1.92361 WP_000781370.1.92384 WP_000781370.1.924 WP_000781370.1.92403 WP_000781370.1.92434 WP_000781370.1.92462 WP_000781370.1.92473 WP_000781370.1.92495 WP_000781370.1.92496 WP_000781370.1.92506 WP_000781370.1.92532 WP_000781370.1.92535 WP_000781370.1.9255 WP_000781370.1.92568 WP_000781370.1.92571 WP_000781370.1.92577 WP_000781370.1.92614 WP_000781370.1.92615 WP_000781370.1.92634 WP_000781370.1.92638 WP_000781370.1.9264 WP_000781370.1.92648 WP_000781370.1.9266 WP_000781370.1.92668 WP_000781370.1.92693 WP_000781370.1.92708 WP_000781370.1.92742 WP_000781370.1.92750 WP_000781370.1.92767 WP_000781370.1.92780 WP_000781370.1.92781 WP_000781370.1.92792 WP_000781370.1.92793 WP_000781370.1.92796 WP_000781370.1.92845 WP_000781370.1.92865 WP_000781370.1.92882 WP_000781370.1.92886 WP_000781370.1.92932 WP_000781370.1.92943 WP_000781370.1.92953 WP_000781370.1.92989 WP_000781370.1.92991 WP_000781370.1.93005 WP_000781370.1.93016 WP_000781370.1.93017 WP_000781370.1.93019 WP_000781370.1.93033 WP_000781370.1.93048 WP_000781370.1.93052 WP_000781370.1.93054 WP_000781370.1.93072 WP_000781370.1.93085 WP_000781370.1.93100 WP_000781370.1.93133 WP_000781370.1.93138 WP_000781370.1.93139 WP_000781370.1.93150 WP_000781370.1.93167 WP_000781370.1.93175 WP_000781370.1.93185 WP_000781370.1.93233 WP_000781370.1.93252 WP_000781370.1.93267 WP_000781370.1.93276 WP_000781370.1.93291 WP_000781370.1.93309 WP_000781370.1.9331 WP_000781370.1.93312 WP_000781370.1.93326 WP_000781370.1.93338 WP_000781370.1.93379 WP_000781370.1.93388 WP_000781370.1.934 WP_000781370.1.93431 WP_000781370.1.93461 WP_000781370.1.93463 WP_000781370.1.93464 WP_000781370.1.93468 WP_000781370.1.93509 WP_000781370.1.93531 WP_000781370.1.93533 WP_000781370.1.93552 WP_000781370.1.9356 WP_000781370.1.93569 WP_000781370.1.93621 WP_000781370.1.93626 WP_000781370.1.93629 WP_000781370.1.93634 WP_000781370.1.93637 WP_000781370.1.93639 WP_000781370.1.93652 WP_000781370.1.93665 WP_000781370.1.93673 WP_000781370.1.93679 WP_000781370.1.93694 WP_000781370.1.93716 WP_000781370.1.93733 WP_000781370.1.93737 WP_000781370.1.93742 WP_000781370.1.93743 WP_000781370.1.93745 WP_000781370.1.93755 WP_000781370.1.93765 WP_000781370.1.93768 WP_000781370.1.938 WP_000781370.1.93800 WP_000781370.1.93870 WP_000781370.1.93873 WP_000781370.1.93877 WP_000781370.1.939 WP_000781370.1.93900 WP_000781370.1.93911 WP_000781370.1.93918 WP_000781370.1.93921 WP_000781370.1.93922 WP_000781370.1.93939 WP_000781370.1.93951 WP_000781370.1.93952 WP_000781370.1.93971 WP_000781370.1.94008 WP_000781370.1.94011 WP_000781370.1.94028 WP_000781370.1.94035 WP_000781370.1.94040 WP_000781370.1.94057 WP_000781370.1.94069 WP_000781370.1.94156 WP_000781370.1.94176 WP_000781370.1.94187 WP_000781370.1.9420 WP_000781370.1.94232 WP_000781370.1.94271 WP_000781370.1.94282 WP_000781370.1.94298 WP_000781370.1.94317 WP_000781370.1.94353 WP_000781370.1.94367 WP_000781370.1.94388 WP_000781370.1.94404 WP_000781370.1.94417 WP_000781370.1.94429 WP_000781370.1.94430 WP_000781370.1.94436 WP_000781370.1.94438 WP_000781370.1.94446 WP_000781370.1.94468 WP_000781370.1.94475 WP_000781370.1.94497 WP_000781370.1.94507 WP_000781370.1.94516 WP_000781370.1.94523 WP_000781370.1.94542 WP_000781370.1.94548 WP_000781370.1.9457 WP_000781370.1.94578 WP_000781370.1.94580 WP_000781370.1.94619 WP_000781370.1.94626 WP_000781370.1.94653 WP_000781370.1.94690 WP_000781370.1.94692 WP_000781370.1.94695 WP_000781370.1.94704 WP_000781370.1.94738 WP_000781370.1.94739 WP_000781370.1.9474 WP_000781370.1.94753 WP_000781370.1.94754 WP_000781370.1.94764 WP_000781370.1.94787 WP_000781370.1.948 WP_000781370.1.94801 WP_000781370.1.94806 WP_000781370.1.94808 WP_000781370.1.94822 WP_000781370.1.94823 WP_000781370.1.94836 WP_000781370.1.94841 WP_000781370.1.94847 WP_000781370.1.94869 WP_000781370.1.94877 WP_000781370.1.94880 WP_000781370.1.94889 WP_000781370.1.9489 WP_000781370.1.94892 WP_000781370.1.94898 WP_000781370.1.949 WP_000781370.1.94907 WP_000781370.1.9491 WP_000781370.1.94934 WP_000781370.1.94935 WP_000781370.1.94938 WP_000781370.1.94949 WP_000781370.1.94955 WP_000781370.1.94963 WP_000781370.1.94993 WP_000781370.1.94997 WP_000781370.1.95005 WP_000781370.1.95022 WP_000781370.1.95036 WP_000781370.1.95037 WP_000781370.1.95062 WP_000781370.1.95080 WP_000781370.1.95084 WP_000781370.1.95105 WP_000781370.1.9513 WP_000781370.1.95161 WP_000781370.1.95233 WP_000781370.1.95243 WP_000781370.1.95244 WP_000781370.1.95310 WP_000781370.1.95329 WP_000781370.1.95332 WP_000781370.1.95364 WP_000781370.1.95366 WP_000781370.1.95368 WP_000781370.1.95378 WP_000781370.1.95381 WP_000781370.1.95390 WP_000781370.1.95395 WP_000781370.1.95398 WP_000781370.1.95400 WP_000781370.1.95403 WP_000781370.1.95424 WP_000781370.1.95428 WP_000781370.1.95431 WP_000781370.1.95438 WP_000781370.1.95449 WP_000781370.1.95490 WP_000781370.1.95518 WP_000781370.1.95521 WP_000781370.1.95563 WP_000781370.1.9559 WP_000781370.1.95595 WP_000781370.1.95596 WP_000781370.1.95604 WP_000781370.1.95611 WP_000781370.1.95628 WP_000781370.1.95634 WP_000781370.1.95655 WP_000781370.1.9566 WP_000781370.1.95666 WP_000781370.1.95680 WP_000781370.1.95756 WP_000781370.1.95759 WP_000781370.1.95771 WP_000781370.1.95783 WP_000781370.1.95784 WP_000781370.1.95800 WP_000781370.1.95821 WP_000781370.1.95824 WP_000781370.1.95827 WP_000781370.1.95835 WP_000781370.1.95846 WP_000781370.1.95849 WP_000781370.1.95858 WP_000781370.1.95861 WP_000781370.1.95865 WP_000781370.1.95869 WP_000781370.1.95916 WP_000781370.1.95929 WP_000781370.1.95931 WP_000781370.1.95932 WP_000781370.1.95951 WP_000781370.1.960 WP_000781370.1.96015 WP_000781370.1.96032 WP_000781370.1.96053 WP_000781370.1.96059 WP_000781370.1.96066 WP_000781370.1.96086 WP_000781370.1.96097 WP_000781370.1.96110 WP_000781370.1.96114 WP_000781370.1.96143 WP_000781370.1.96145 WP_000781370.1.96177 WP_000781370.1.96222 WP_000781370.1.96223 WP_000781370.1.96229 WP_000781370.1.96247 WP_000781370.1.96253 WP_000781370.1.96263 WP_000781370.1.96278 WP_000781370.1.96279 WP_000781370.1.96281 WP_000781370.1.96290 WP_000781370.1.96293 WP_000781370.1.96299 WP_000781370.1.96303 WP_000781370.1.9631 WP_000781370.1.96339 WP_000781370.1.96341 WP_000781370.1.96378 WP_000781370.1.96392 WP_000781370.1.96394 WP_000781370.1.9641 WP_000781370.1.96417 WP_000781370.1.96420 WP_000781370.1.96457 WP_000781370.1.96478 WP_000781370.1.96479 WP_000781370.1.96484 WP_000781370.1.9649 WP_000781370.1.96494 WP_000781370.1.965 WP_000781370.1.96519 WP_000781370.1.96541 WP_000781370.1.96558 WP_000781370.1.96562 WP_000781370.1.9657 WP_000781370.1.96585 WP_000781370.1.96609 WP_000781370.1.9661 WP_000781370.1.96617 WP_000781370.1.96633 WP_000781370.1.96650 WP_000781370.1.96659 WP_000781370.1.96676 WP_000781370.1.9668 WP_000781370.1.96683 WP_000781370.1.96695 WP_000781370.1.96701 WP_000781370.1.9671 WP_000781370.1.96743 WP_000781370.1.96753 WP_000781370.1.96759 WP_000781370.1.96762 WP_000781370.1.96779 WP_000781370.1.96817 WP_000781370.1.96820 WP_000781370.1.96850 WP_000781370.1.96864 WP_000781370.1.96894 WP_000781370.1.9690 WP_000781370.1.96907 WP_000781370.1.9691 WP_000781370.1.96924 WP_000781370.1.96936 WP_000781370.1.96944 WP_000781370.1.96984 WP_000781370.1.97011 WP_000781370.1.97027 WP_000781370.1.97049 WP_000781370.1.97059 WP_000781370.1.9708 WP_000781370.1.97119 WP_000781370.1.97123 WP_000781370.1.97147 WP_000781370.1.97160 WP_000781370.1.97170 WP_000781370.1.97195 WP_000781370.1.97200 WP_000781370.1.97226 WP_000781370.1.9723 WP_000781370.1.97231 WP_000781370.1.97238 WP_000781370.1.97247 WP_000781370.1.97248 WP_000781370.1.97269 WP_000781370.1.97292 WP_000781370.1.97344 WP_000781370.1.97356 WP_000781370.1.97360 WP_000781370.1.97361 WP_000781370.1.97379 WP_000781370.1.97387 WP_000781370.1.97418 WP_000781370.1.97421 WP_000781370.1.97434 WP_000781370.1.97439 WP_000781370.1.97459 WP_000781370.1.97464 WP_000781370.1.9747 WP_000781370.1.97490 WP_000781370.1.97502 WP_000781370.1.97525 WP_000781370.1.97527 WP_000781370.1.97538 WP_000781370.1.97544 WP_000781370.1.97549 WP_000781370.1.97560 WP_000781370.1.97571 WP_000781370.1.97619 WP_000781370.1.97654 WP_000781370.1.97667 WP_000781370.1.97675 WP_000781370.1.97685 WP_000781370.1.97705 WP_000781370.1.97711 WP_000781370.1.97770 WP_000781370.1.97775 WP_000781370.1.97778 WP_000781370.1.978 WP_000781370.1.97802 WP_000781370.1.97822 WP_000781370.1.97823 WP_000781370.1.97825 WP_000781370.1.97890 WP_000781370.1.97895 WP_000781370.1.97919 WP_000781370.1.97930 WP_000781370.1.97932 WP_000781370.1.97937 WP_000781370.1.97962 WP_000781370.1.97982 WP_000781370.1.97996 WP_000781370.1.98000 WP_000781370.1.98005 WP_000781370.1.98012 WP_000781370.1.98026 WP_000781370.1.9803 WP_000781370.1.98082 WP_000781370.1.98102 WP_000781370.1.98115 WP_000781370.1.98139 WP_000781370.1.9816 WP_000781370.1.98167 WP_000781370.1.9817 WP_000781370.1.98208 WP_000781370.1.98220 WP_000781370.1.98232 WP_000781370.1.98235 WP_000781370.1.98239 WP_000781370.1.98241 WP_000781370.1.98244 WP_000781370.1.98251 WP_000781370.1.98284 WP_000781370.1.98292 WP_000781370.1.98294 WP_000781370.1.98301 WP_000781370.1.98355 WP_000781370.1.98357 WP_000781370.1.98400 WP_000781370.1.98424 WP_000781370.1.98429 WP_000781370.1.9844 WP_000781370.1.98442 WP_000781370.1.98451 WP_000781370.1.98466 WP_000781370.1.98477 WP_000781370.1.98480 WP_000781370.1.98484 WP_000781370.1.98498 WP_000781370.1.98549 WP_000781370.1.98578 WP_000781370.1.9858 WP_000781370.1.98587 WP_000781370.1.98603 WP_000781370.1.98614 WP_000781370.1.98626 WP_000781370.1.98628 WP_000781370.1.98633 WP_000781370.1.9864 WP_000781370.1.98641 WP_000781370.1.98654 WP_000781370.1.98665 WP_000781370.1.98668 WP_000781370.1.98683 WP_000781370.1.98702 WP_000781370.1.98727 WP_000781370.1.98757 WP_000781370.1.98775 WP_000781370.1.98776 WP_000781370.1.98784 WP_000781370.1.98875 WP_000781370.1.98886 WP_000781370.1.98908 WP_000781370.1.98976 WP_000781370.1.98988 WP_000781370.1.99006 WP_000781370.1.99029 WP_000781370.1.99046 WP_000781370.1.99053 WP_000781370.1.99060 WP_000781370.1.9907 WP_000781370.1.99110 WP_000781370.1.99168 WP_000781370.1.99209 WP_000781370.1.99246 WP_000781370.1.99265 WP_000781370.1.99292 WP_000781370.1.99295 WP_000781370.1.9930 WP_000781370.1.99302 WP_000781370.1.99304 WP_000781370.1.99306 WP_000781370.1.99307 WP_000781370.1.99310 WP_000781370.1.99319 WP_000781370.1.99334 WP_000781370.1.99345 WP_000781370.1.99349 WP_000781370.1.9935 WP_000781370.1.99361 WP_000781370.1.99366 WP_000781370.1.99392 WP_000781370.1.9940 WP_000781370.1.99400 WP_000781370.1.99401 WP_000781370.1.99427 WP_000781370.1.99446 WP_000781370.1.99453 WP_000781370.1.99458 WP_000781370.1.99471 WP_000781370.1.99472 WP_000781370.1.99486 WP_000781370.1.99498 WP_000781370.1.9950 WP_000781370.1.99511 WP_000781370.1.99534 WP_000781370.1.99549 WP_000781370.1.99562 WP_000781370.1.99571 WP_000781370.1.99592 WP_000781370.1.99602 WP_000781370.1.99603 WP_000781370.1.99619 WP_000781370.1.99632 WP_000781370.1.99641 WP_000781370.1.99666 WP_000781370.1.99694 WP_000781370.1.99698 WP_000781370.1.99734 WP_000781370.1.99771 WP_000781370.1.99774 WP_000781370.1.99782 WP_000781370.1.99791 WP_000781370.1.99804 WP_000781370.1.99827 WP_000781370.1.99869 WP_000781370.1.99874 WP_000781370.1.99891 WP_000781370.1.99892 WP_000781370.1.99912 WP_000781370.1.99929 YP_006119822.1.29421 YP_006779312.1.12065 gi|170680944|ref|YP_001743751.1| gi|253773552|ref|YP_003036383.1| gi|260855197|ref|YP_003229088.1| gi|387829444|ref|YP_003349381.1| gi|386638997|ref|YP_006105795.1| gi|386709298|ref|YP_006173019.1| gi|544390143|ref|YP_008564642.1| gi|157160953|ref|YP_001458271.1| 2icp_A 2ict_A gi|238900699|ref|YP_002926495.1| 2ictA gi|26247766|ref|NP_753806.1| gi|187734151|ref|YP_001880315.1| gi|386709298|ref|YP_006173019.1| gi|443617539|ref|YP_007381395.1| gi|145698261|ref|NP_415994.4| gi|386629206|ref|YP_006148926.1| gi|209918757|ref|YP_002292841.1| gi|386624025|ref|YP_006143753.1| gi|110641656|ref|YP_669386.1| gi|386599318|ref|YP_006100824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]