SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2iu7_G from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2iu7_G
Domain Number 1 Region: 88-156
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.32e-53
Family Cyanase C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.22e-20
Family Cyanase N-terminal domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2iu7_G
Sequence length 156
Comment mol:protein length:156 CYANATE HYDRATASE
Sequence
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
isainfkldvkkvadpeggeravitldgkylptkpf
Download sequence
Identical sequences 2iu7_A 2iu7_B 2iu7_C 2iu7_D 2iu7_E 2iu7_F 2iu7_G 2iu7_H 2iu7_I 2iu7_J 2iu7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]