SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ivq_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ivq_B
Domain Number 1 Region: 88-156
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.02e-53
Family Cyanase C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.22e-20
Family Cyanase N-terminal domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2ivq_B
Sequence length 156
Comment mol:protein length:156 CYANATE HYDRATASE
Sequence
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
isainfkldvkkvadpeggeravitldgkylptkpf
Download sequence
Identical sequences 2ivq_A 2ivq_B 2ivq_C 2ivq_D 2ivq_E 2ivq_F 2ivq_G 2ivq_H 2ivq_I 2ivq_J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]